Player Tauranax has unknown 'enchant=' token 'colossus' at slot main_hand

		
close

SimulationCraft 510-6

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
HPS Chart
Natadu

Natadu : 64765 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
64765.5 64765.5 103.40 / 0.16% 2700 / 4.2% 16.5 3906.4 3852.7 Mana 0.00% 39.0 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Natadu/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Ua!001112
Glyphs
  • moonbeast
  • stampede
  • rebirth
  • grace
  • stag
  • charm_woodland_creature
Professions
  • inscription: 600
  • jewelcrafting: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:175317|121579|113594|88342|50515|35466&chds=0,350634&chco=69CCF0,336600,69CCF0,4E9978,69CCF0,336600&chm=t++175317++starfall,69CCF0,0,0,15|t++121579++sunfire,336600,1,0,15|t++113594++moonfire,69CCF0,2,0,15|t++88342++starsurge,4E9978,3,0,15|t++50515++starfire,69CCF0,4,0,15|t++35466++wrath,336600,5,0,15&chtt=Natadu Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,17,15,12,12,11,2,0&chds=0,100&chdls=ffffff&chco=69CCF0,336600,4E9978,69CCF0,336600,69CCF0,336600,336600&chl=starfire|wrath|starsurge|moonfire|sunfire|starfall|stormlash|wild_mushroom_detonate&chtt=Natadu Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:fihlmqprstvy0234677844330zutronkiggfdbZXVVUTTTTUVWWWWWVVUUUTTTSSSSSRRRQQQQPPPPPPPPQRSSTTTTTTTTTTTTSSSSSSRRRQQQQPPPPPPPPQRSSTTTTTTTTTTTTSSSSSSRRRQQQQPPPPPPPPQRRSTTTTTTTTTTTTTSSSRSSSSSSSSSTTUVWYacegijklmmmlllkkkkjihgfecbaZYXXWWWVVUTTTSSSRRRQQQQPPPPPPQQRSSTTTTTTTTTTTTSSSSSSRRRQQQQPPPPPPPQQRSSTTTTTTTTTTTTTTTTTTTTTTSSSSSSSSSSSSTTUUVVVUUUUTTTTSSSSSSRRRQQQQPPPPPPPQQRSUVWWXYYZZabcdefghijjjjiihggfeedcbaZYXWVUTSSRRQQQQQQRRSSTTTTTTTTTTTSSSSSSRRRQQQQPPPPPPPPQQRSSSTTTTTTTTTTSSSSSSRRRQQQQPPPPPPPPQQRRSSTTTTTTTTTSSSSSSSRRRQQQQPPPPPPPPPQRRSSSTTTTTSSSSSRRRRRQQPPPONNMM&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3712,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=64765|max=174467&chxp=1,1,37,100&chtt=Natadu DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,5,3,9,6,12,5,18,17,18,16,22,36,21,31,35,40,39,60,38,45,30,39,43,46,43,29,39,33,32,24,21,32,18,15,24,13,7,3,7,7,3,3,5,0,1,1,0,1,2&chds=0,60&chbh=5&chxt=x&chxl=0:|min=60657|avg=64765|max=70033&chxp=0,1,44,100&chtt=Natadu DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.8,31.5,10.8,6.8,6.2,4.0,0.8&chds=0,100&chdls=ffffff&chco=69CCF0,336600,4E9978,69CCF0,336600,69CCF0,C79C6E&chl=starfire 179.3s|wrath 142.0s|starsurge 48.5s|moonfire 30.9s|sunfire 28.2s|starfall 18.1s|incarnation 3.5s&chtt=Natadu Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Natadu 64765
moonfire 7788 12.0% 27.2 16.73sec 128939 113594 12325 26918 14204 12.9% 0.0% 0.0% 0.0% 252.6 10796 22469 12353 13.3% 0.0% 81.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.20 27.20 252.60 252.60 1.1351 1.4516 3506641.31 3506641.31 0.00 8820.78 113593.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.69 87.12% 12324.92 0 20557 12336.37 10243 14020 292004 292004 0.00
crit 3.50 12.88% 26917.88 22649 42347 26211.71 0 42347 94274 94274 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 218.9 86.66% 10796.08 7164 19594 10807.88 10207 11544 2363370 2363370 0.00
crit 33.7 13.34% 22468.59 14759 40364 22507.80 18681 27362 756994 756994 0.00
DPS Timeline Chart

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_eclipse.up&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every {$t1=2} seconds.
  • description:Burns the enemy for {$s2=563 to 688 + 24.0%} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}.{$?s79577=false}[ Your Starfire and Starsurge critical strikes on the target will extend your Moonfire's duration by {$8921t1=2} sec.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 7053 10.9% 15.3 31.70sec 206838 175317 0 0 0 0.0% 0.0% 0.0% 0.0% 151.6 18266 37931 20925 13.5% 0.0% 33.6%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 15.33 151.57 151.57 1.1798 1.0000 3171313.30 3171313.30 0.00 18692.50 175317.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.1 86.49% 18266.49 10100 27515 18283.17 17268 19232 2394477 2394477 0.00
crit 20.5 13.51% 37931.10 24615 56680 37949.06 30647 46977 776837 776837 0.00
DPS Timeline Chart

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:19560.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.starfall.up
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing {$50288s1=534 to 620 + 33.0%} Arcane damage. Maximum {$48505s2=20} stars. Lasts {$48505d=10 seconds}. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing {$50288s1=534 to 620 + 33.0%} Arcane damage. Maximum {$48505s2=20} stars. Lasts {$48505d=10 seconds}. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.330000
  • base_dd_min:533.66
  • base_dd_max:620.20
starfire 20111 31.1% 88.7 4.97sec 102139 50515 89013 186280 102139 13.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.69 88.69 0.00 0.00 2.0220 0.0000 9058789.39 9058789.39 0.00 50514.92 50514.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.72 86.50% 89012.70 56482 153426 89096.94 82763 95636 6829146 6829146 0.00
crit 11.97 13.50% 186279.69 116353 316058 186806.75 134243 283076 2229643 2229643 0.00
DPS Timeline Chart

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Causes {$s1=3570 to 4590 + 181.1%} Arcane damage to the target.{$?s78674=true}[ Generates {$s2=20} Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.811000
  • base_dd_min:3570.08
  • base_dd_max:4590.11
starsurge 9517 14.7% 35.6 12.71sec 120309 88342 105809 218833 120698 13.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.64 35.53 0.00 0.00 1.3619 0.0000 4287758.37 4287758.37 0.00 88341.82 88341.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.85 86.83% 105809.27 68086 185126 105889.48 91894 117762 3263644 3263644 0.00
crit 4.68 13.17% 218832.58 140257 381360 217085.10 0 369715 1024115 1024115 0.00
DPS Timeline Chart

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown_react
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes {$78674s1=16615 to 18073} Spellstorm damage to the target and generates {$78674s2=20} Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.197000
  • base_dd_min:3843.38
  • base_dd_max:5302.08
stormlash 1308 2.0% 21.9 15.23sec 26499 0 23015 48296 26496 13.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.92 21.92 0.00 0.00 0.0000 0.0000 580760.48 580760.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.90 86.22% 23014.94 8576 42514 23028.91 18302 26493 434893 434893 0.00
crit 3.02 13.78% 48296.12 17666 87579 46325.95 0 87579 145867 145867 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:9900.00
  • base_dd_max:9900.00
sunfire 7603 11.7% 27.5 16.49sec 124558 121579 10339 25265 12074 11.6% 0.0% 0.0% 0.0% 253.0 10690 22239 12223 13.3% 0.0% 81.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.49 27.49 252.96 252.96 1.0245 1.4556 3423779.67 3423779.67 0.00 8637.86 121578.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.29 88.38% 10338.83 0 20557 10334.66 8692 11807 251182 251182 0.00
crit 3.20 11.62% 25265.10 22649 42347 24078.39 0 41054 80716 80716 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 219.4 86.73% 10690.10 7164 19594 10700.60 10077 11314 2345245 2345245 0.00
crit 33.6 13.27% 22239.22 14759 40364 22258.26 18696 27199 746636 746636 0.00
DPS Timeline Chart

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$s1=263} Nature damage every {$t1=2} seconds.
  • description:Burns the enemy for {$s2=1958 to 2083} Nature damage and then an additional $o1 Nature damage over {$d=14 seconds}. Your Wrath and Starsurge critical strikes on the target will extend your Sunfire's duration by {$93402t1=2} sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 218 0.3% 1.0 nansec 96743 0 20632 43649 24182 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 4.00 0.00 0.00 0.0000 0.0000 96743.38 96743.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.38 84.56% 20631.81 0 28335 20607.74 0 28335 69785 69785 0.00
crit 0.62 15.44% 43649.35 0 58370 21925.53 0 58370 26959 26959 0.00
DPS Timeline Chart

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:6119.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.wild_mushroom.stack>0&buff.solar_eclipse.up
Spelldata
  • id:88751
  • name:Wild Mushroom: Detonate
  • school:nature
  • tooltip:
  • description:Detonates all of your Wild Mushrooms, dealing {$78777s1=2321 to 2382} Nature damage to all nearby targets within $78777A1 yards, and creating a Fungal Growth in each mushroom's wake covering an area within 8 yards, slowing all enemy targets by {$81281s1=50}%, and lasting {$81283d=20 seconds}.
wrath 11167 17.3% 91.9 4.43sec 54810 35466 48225 99266 54974 13.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.91 91.63 0.00 0.00 1.5454 0.0000 5037460.30 5037460.30 0.00 35465.58 35465.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.51 86.77% 48224.88 34818 94612 48263.19 45839 51046 3834190 3834190 0.00
crit 12.12 13.23% 99265.61 71725 194900 99339.76 78729 128093 1203271 1203271 0.00
DPS Timeline Chart

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Causes {$s1=8649 to 9261} Nature damage to the target. {$?s78674=true}[Generates {$s2=15} Lunar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.119000
  • base_dd_min:2143.77
  • base_dd_max:2756.28

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.07%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.9 0.0 182.8sec 182.8sec 9.37% 9.37%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • celestial_alignment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Damage done by your Nature and Arcane spells increased by $w1%. Cannot gain Lunar or Solar Energy.
  • description:Grants you the simultaneous damage benefit of both your Lunar Eclipse and Solar Eclipse, increasing damage done by your Nature and Arcane spells by {$s1=15}%. In addition, casting Moonfire also applies the the periodic damage effect of Sunfire to your target. Activating this ability consumes all Lunar and Solar Energy and prevents gaining more during its duration. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
chosen_of_elune 3.0 0.0 181.9sec 181.9sec 19.10% 28.47%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • chosen_of_elune_1:19.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122114
  • name:Chosen of Elune
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 1.0 0.0 197.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
lunar_eclipse 14.3 0.0 32.3sec 32.3sec 42.73% 83.37%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_lunar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lunar_eclipse_1:42.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Damage done by your Arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Arcane spells by {$s1=15}%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
lunar_shower 27.5 22.3 16.5sec 9.0sec 24.18% 44.70%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_lunar_shower
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • lunar_shower_1:9.42%
  • lunar_shower_2:14.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81192
  • name:Lunar Shower
  • tooltip:Direct damage of your Moonfire and Sunfire increased by {$s1=45}%, and mana cost reduced by {$s2=30}%.
  • description:When you cast Moonfire or Sunfire, you gain Lunar Shower. Lunar Shower increases the direct damage done by your Moonfire and Sunfire spells by {$81192s1=45}%, and reduces the mana cost by {$81192s2=30}%. This effect stacks up to 3 times and lasts {$81192d=3 seconds}.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 22.6 2.6 20.2sec 18.1sec 81.79% 81.79%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • natures_grace_1:81.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16886
  • name:Nature's Grace
  • tooltip:Spell casting speed increased by {$s1=15}%.
  • description:You gain {$s1=15}% spell haste each time you trigger an Eclipse.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
natures_vigil 2.9 0.0 181.9sec 181.9sec 19.04% 28.32%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • duration:30.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • natures_vigil_1:19.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:124974
  • name:Nature's Vigil
  • tooltip:Damage and healing done increased by {$s1=20}%. {$s3=25}% of single-target damage done heals a nearby target and {$s3=25}% of single-target healing done damages a nearby target.
  • description:Increases all damage and healing done by {$s1=20}% for {$d=30 seconds}. While active, all single-target healing spells also damage a nearby enemy target for {$s3=25}% of the healing done, and all single-target damage spells and abilities also heal a nearby friendly target for {$s3=25}% of the damage done.
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:100.00%
shooting_stars 18.9 1.3 22.7sec 21.2sec 7.75% 50.06%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_shooting_stars
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • shooting_stars_1:7.75%

Trigger Attempt Success

  • trigger_pct:29.89%

Spelldata details

  • id:93400
  • name:Shooting Stars
  • tooltip:Your next Starsurge spell is instant cast.
  • description:You have a $93399h% chance when you deal critical periodic damage with your Moonfire or Sunfire to instantly reset the cooldown of your Starsurge and cause its next cast within {$93400d=12 seconds} to be instant.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
solar_eclipse 13.8 0.0 32.8sec 32.8sec 39.81% 63.42%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_solar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • solar_eclipse_1:39.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Damage done by your Nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Nature spells by {$s1=15}%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
starfall 15.3 0.0 30.3sec 31.7sec 33.71% 33.71%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • starfall_1:33.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48505
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing {$50288s1=534 to 620 + 33.0%} Arcane damage. Maximum {$48505s2=20} stars. Lasts {$48505d=10 seconds}. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
  • max_stacks:
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
windsong_crit 5.4 1.0 72.7sec 59.8sec 15.65% 15.87%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:15.65%

    Trigger Attempt Success

    • trigger_pct:2.10%
windsong_haste 5.4 1.0 72.5sec 59.6sec 15.41% 15.84%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:15.41%

    Trigger Attempt Success

    • trigger_pct:2.07%
windsong_mastery 5.5 0.9 71.9sec 59.7sec 15.53% 15.63%

Buff details

  • buff initial source:Natadu
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:15.53%

    Trigger Attempt Success

    • trigger_pct:2.09%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Natadu
moonfire Mana 26.1 114982.6 4409.7 4227.9 30.5
starfall Mana 15.3 299893.9 19560.0 19559.6 10.6
starfire Mana 88.7 548098.0 6180.0 6179.9 16.5
starsurge Mana 35.6 220261.4 6180.0 6180.2 19.5
sunfire Mana 23.7 109602.9 4620.7 3987.4 31.2
wild_mushroom_detonate Mana 1.0 6119.0 6119.0 6119.0 15.8
wrath Mana 91.9 463221.4 5040.0 5040.1 10.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.90 669364.12 (38.51%) 371.07 7097.25 1.05%
eclipse Mana 25.24 1068586.46 (61.49%) 42343.73 1581193.54 59.67%
Resource RPS-Gain RPS-Loss
Mana 3852.70 3906.41
Combat End Resource Mean Min Max
Health 407909.00 407909.00 407909.00
Mana 275771.90 249436.00 300000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.0%
treant-Mana Cap 1.0%
treant-Mana Cap 1.0%
mirror_image-Mana Cap 1.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Natadu Damage Per Second
Count 999
Mean 64765.48
Minimum 60657.21
Maximum 70033.25
Spread ( max - min ) 9376.05
Range [ ( max - min ) / 2 * 100% ] 7.24%
Standard Deviation 1667.5348
5th Percentile 62026.20
95th Percentile 67426.81
( 95th Percentile - 5th Percentile ) 5400.61
Mean Distribution
Standard Deviation 52.7585
95.00% Confidence Intervall ( 64662.08 - 64868.89 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2546
0.1 Scale Factor Error with Delta=300 23737
0.05 Scale Factor Error with Delta=300 94949
0.01 Scale Factor Error with Delta=300 2373741
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 64765.48
Distribution Chart

Damage

Sample Data
Count 999
Mean 29163246.20
Distribution Chart

DTPS

Sample Data Natadu Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Natadu Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Natadu Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 292.87
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 moonkin_form
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
8 15.33 starfall,if=!buff.starfall.up
9 0.00 treants,if=talent.force_of_nature.enabled
A 1.00 wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
B 0.00 natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled
C 0.00 healing_touch,if=talent.dream_of_cenarius.enabled&!buff.dream_of_cenarius_damage.up&mana.pct>25
D 2.96 incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
E 2.86 celestial_alignment,if=(!buff.lunar_eclipse.up&!buff.solar_eclipse.up)&(buff.chosen_of_elune.up|!talent.incarnation.enabled|cooldown.incarnation.remains>10)
F 2.95 natures_vigil,if=talent.natures_vigil.enabled&((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))
G 14.29 moonfire,cycle_targets=1,if=buff.lunar_eclipse.up&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
H 10.89 sunfire,cycle_targets=1,if=buff.solar_eclipse.up&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
I 0.00 hurricane,if=active_enemies>4&buff.solar_eclipse.up&buff.natures_grace.up
J 10.87 moonfire,cycle_targets=1,if=active_enemies<5&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
K 11.40 sunfire,cycle_targets=1,if=active_enemies<5&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
L 0.00 hurricane,if=active_enemies>5&buff.solar_eclipse.up&mana.pct>25
M 0.92 moonfire,cycle_targets=1,if=buff.lunar_eclipse.up&ticks_remain<2
N 1.43 sunfire,cycle_targets=1,if=buff.solar_eclipse.up&ticks_remain<2
O 0.00 hurricane,if=active_enemies>4&buff.solar_eclipse.up&mana.pct>25
P 35.70 starsurge,if=cooldown_react
Q 15.14 starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
R 0.21 wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
S 73.93 starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
T 91.99 wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
U 0.00 moonfire,moving=1,cycle_targets=1,if=ticks_remain<2
V 0.00 sunfire,moving=1,cycle_targets=1,if=ticks_remain<2
W 0.00 wild_mushroom,moving=1,if=buff.wild_mushroom.stack<buff.wild_mushroom.max_stack
X 0.00 starsurge,moving=1,if=buff.shooting_stars.react
Y 0.00 moonfire,moving=1,if=buff.lunar_eclipse.up
Z 0.00 sunfire,moving=1

Sample Sequence

8PDFGKSSS8SSEAGQPQQ8QQPQMSSSHJTTTTPTTTTT8GKPSPSSSSSHJTPTTTTPTTT8GKSSSPSSPSHJTTTTPTTPTT8GKSSSSPSSSHJTTTTPTTTTT8GKPSSSPSSSHJTDFPTTTTTTTE78GQPQQQQNTTTP8GKSSSSSPSSHJTTTTTTPTTT8GKSSSSPSSSHJTPTTTTTTTT8GKPSSSPSSPHJTTPTTTTTTT8GKPSSSPSSSHJTTTTPTTTTP8DFGKSSSSSE8GPQQQQQMSSPHJTTTTTTTTPT8GKSSSSSPSSHJTTTTTTPTT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 114 109 0
Agility 96 91 0
Stamina 18679 16981 16861
Intellect 16697 14537 13680
Spirit 9469 9469 9279
Health 407909 384137 0
Mana 300000 300000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 24750 20340 5813
Spell Hit 27.29% 27.29% 0
Spell Crit 15.79% 9.93% 1408
Spell Haste 15.71% 10.20% 4335
ManaReg per Second 1500 1500 0
Attack Power 411 369 0
Melee Hit 27.29% 27.29% 0
Melee Crit 14.90% 9.90% 1408
Melee Haste 10.20% 10.20% 4335
Swing Speed 21.22% 10.20% 4335
Expertise 0.00% 0.00% 0
Armor 17551 17551 17551
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.43% 0.10% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 33.83% 24.45% 3023

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Natadu"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Natadu/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/178/27279794-avatar.jpg"
level=90
race=tauren
spec=balance
role=spell
position=back
professions=jewelcrafting=600/inscription=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!001112
glyphs=moonbeast/stampede/rebirth/grace/stag/charm_woodland_creature

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
actions+=/starfall,if=!buff.starfall.up
actions+=/treants,if=talent.force_of_nature.enabled
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled
actions+=/healing_touch,if=talent.dream_of_cenarius.enabled&!buff.dream_of_cenarius_damage.up&mana.pct>25
actions+=/incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
actions+=/celestial_alignment,if=(!buff.lunar_eclipse.up&!buff.solar_eclipse.up)&(buff.chosen_of_elune.up|!talent.incarnation.enabled|cooldown.incarnation.remains>10)
actions+=/natures_vigil,if=talent.natures_vigil.enabled&((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))
actions+=/moonfire,cycle_targets=1,if=buff.lunar_eclipse.up&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/sunfire,cycle_targets=1,if=buff.solar_eclipse.up&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/hurricane,if=active_enemies>4&buff.solar_eclipse.up&buff.natures_grace.up
actions+=/moonfire,cycle_targets=1,if=active_enemies<5&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/sunfire,cycle_targets=1,if=active_enemies<5&(remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/hurricane,if=active_enemies>5&buff.solar_eclipse.up&mana.pct>25
actions+=/moonfire,cycle_targets=1,if=buff.lunar_eclipse.up&ticks_remain<2
actions+=/sunfire,cycle_targets=1,if=buff.solar_eclipse.up&ticks_remain<2
actions+=/hurricane,if=active_enemies>4&buff.solar_eclipse.up&mana.pct>25
actions+=/starsurge,if=cooldown_react
actions+=/starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
actions+=/wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
actions+=/moonfire,moving=1,cycle_targets=1,if=ticks_remain<2
actions+=/sunfire,moving=1,cycle_targets=1,if=ticks_remain<2
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<buff.wild_mushroom.max_stack
actions+=/starsurge,moving=1,if=buff.shooting_stars.react
actions+=/moonfire,moving=1,if=buff.lunar_eclipse.up
actions+=/sunfire,moving=1

head=hood_of_stilled_winds,id=89831,gems=revitalizing_primal_160haste_160spi_180int,reforge=crit_spi
neck=zians_choker_of_coalesced_shadow,id=86083,reforge=mastery_haste
shoulders=spaulders_of_the_divided_mind,id=86039,gems=80int_160spi_60int,enchant=520int_100crit,reforge=mastery_haste
back=drape_of_gathering_clouds,id=86827,enchant=180int,reforge=mastery_haste
chest=robes_of_eighty_lights,id=86180,gems=80int_160spi_80int_160haste_120int,enchant=200spi,reforge=mastery_haste
shirt=senjin_doublet,id=45669
wrists=clever_ashyos_armbands,id=88885,enchant=170mastery,reforge=crit_spi
hands=gauntlets_of_undesired_gifts,id=86159,gems=60int_120spi_60crit,enchant=170haste,reforge=crit_haste
waist=stonebound_cinch,id=87019,gems=80int_160haste_80int_160spi_80int_160spi_120spi
legs=magnetized_leggings,id=86150,gems=80int_160spi_80int_160spi_120int,enchant=285int_165spi
feet=crushing_treads_of_anger,id=90908,enchant=140mastery,reforge=mastery_haste
finger1=circuit_of_the_frail_soul,id=86038,reforge=crit_haste
finger2=fengs_ring_of_dreams,id=89803,reforge=mastery_haste
trinket1=qinxis_polarizing_seal,id=86805
trinket2=relic_of_chiji,id=79330
main_hand=inscribed_crane_staff,id=79340,enchant=windsong,reforge=mastery_haste

# Gear Summary
# gear_stamina=16861
# gear_intellect=13680
# gear_spirit=9279
# gear_spell_power=5813
# gear_crit_rating=1408
# gear_haste_rating=4335
# gear_mastery_rating=3023
# gear_armor=17551
# meta_gem=revitalizing_primal
# main_hand=inscribed_crane_staff,weapon=staff_3.30speed_4895min_7343max,enchant=windsong

Ellimac

Ellimac : 78542 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
78541.9 78541.9 115.87 / 0.15% 3102 / 3.9% 5347.5 14.7 14.5 Energy 48.41% 31.7 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Ellimac/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#UZ!202010
Glyphs
  • cat_form
  • savagery
  • rebirth
  • aquatic_form
  • orca
  • stag
Professions
  • leatherworking: 600
  • skinning: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:246108|119020|83950|49027|18846&chds=0,492217&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++246108++rake,C79C6E,0,0,15|t++119020++ferocious_bite,C79C6E,1,0,15|t++83950++thrash_cat,C79C6E,2,0,15|t++49027++shred,C79C6E,3,0,15|t++18846++cat_melee,C79C6E,4,0,15&chtt=Ellimac Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:24,23,23,19,7,2,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,62480C,336600&chl=cat_melee|rip|rake|shred|ferocious_bite|thrash_cat|elemental_force|stormlash&chtt=Ellimac Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:ux00012355567778776420xvutrqolkjihhggfeddddeddccbbbaaaabccddeeeeeeeeeeeefeeedcbbbaaaaabbbccccbcccccccccccccbbaaaaaaaabcccccdddddccccdddcccbbaaaaaaabbcccdddeeeddddeeeddddcbbbaaaaabbcdeefghijjkllmmmnnmmlljjihhggfffffeeeeeedddddddddccbbaaaaaaabbccccdddddddddeeeeedddcccbbbbcccdcdddccccccccccdcccbbbbabbbcddeeffffffffgggggggffeedccccccdddeeeeeeeeeeeeffffffeedddddddeefghijkkmnoppqrrsssssrrqponmllkkkjjjiiiihhhhhhhhhhggffeedddddeefffggffffffffgggggfffeeedddeefffggggggggggggggggffeeeddddddeeffgggggghhhhhhiiihhhhggffffffgghhhhhihhhhhhhhhhgggfffeeddddddddddccddd&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5349,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=78542|max=146824&chxp=1,1,53,100&chtt=Ellimac DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,3,3,6,11,11,12,20,8,15,22,23,35,34,26,47,34,43,34,42,48,52,57,38,45,52,43,35,37,16,22,28,12,17,17,9,8,10,4,3,2,3,2,2,1,2,2,1&chds=0,57&chbh=5&chxt=x&chxl=0:|min=73355|avg=78542|max=84538&chxp=0,1,46,100&chtt=Ellimac DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.1,7.2,4.6,3.7,3.0,2.0,48.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=shred 140.4s|rake 32.6s|ferocious_bite 20.9s|savage_roar 16.8s|rip 13.6s|thrash_cat 8.9s|waiting 218.4s&chtt=Ellimac Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Ellimac 78542
berserk 0 0.0% 2.9 184.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
cat_melee 18845 24.0% 526.4 0.86sec 16136 18846 12417 25847 16136 34.0% 1.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 526.37 526.37 0.00 0.00 0.8562 0.0000 8493574.68 8493574.68 0.00 18846.34 18846.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 216.26 41.08% 12417.39 8665 16934 12419.84 12197 12675 2685340 2685340 0.00
crit 179.12 34.03% 25846.63 17849 34884 25853.88 25244 26422 4629606 4629606 0.00
glance 125.99 23.94% 9355.20 6498 12700 9357.75 9108 9671 1178629 1178629 0.00
dodge 2.82 0.53% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.19 0.42% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
elemental_force 688 0.9% 88.3 5.11sec 3514 0 3150 6489 3514 11.8% 0.9% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.30 88.30 0.00 0.00 0.0000 0.0000 310245.74 310245.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.07 87.29% 3150.00 3150 3150 3150.00 3150 3150 242777 242777 0.00
crit 10.40 11.78% 6489.00 6489 6489 6482.50 0 6489 67469 67469 0.00
miss 0.83 0.94% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: elemental_force

Static Values
  • id:0
  • school:elemental
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3000.00
  • base_dd_max:3000.00
ferocious_bite 5533 7.0% 19.5 23.54sec 127762 119020 77798 163896 127756 58.8% 0.9% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.48 19.48 0.00 0.00 1.0735 0.0000 2488356.08 2488356.08 0.00 119020.24 119020.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.84 40.26% 77798.17 8337 146242 77902.77 41052 128157 610074 610074 0.00
crit 11.46 58.84% 163896.43 17173 301258 164363.09 109027 230698 1878282 1878282 0.00
dodge 0.10 0.52% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.38% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point{$?s67598=false}[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for {$67598m1=1}% of your total maximum health for each {$67598m2=10} Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.] When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target. Critical strike chance increased by {$s2=25}% against bleeding targets. 1 point : ${{$m1=13}+$b1*1+0.196*$AP}-${$M1+$b1*1+0.196*$AP} damage 2 points: ${{$m1=13}+$b1*2+0.196*2*$AP}-${$M1+$b1*2+0.196*2*$AP} damage 3 points: ${{$m1=13}+$b1*3+0.196*3*$AP}-${$M1+$b1*3+0.196*3*$AP} damage 4 points: ${{$m1=13}+$b1*4+0.196*4*$AP}-${$M1+$b1*4+0.196*4*$AP} damage 5 points: ${{$m1=13}+$b1*5+0.196*5*$AP}-${$M1+$b1*5+0.196*5*$AP} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.784000
  • base_dd_min:315.19
  • base_dd_max:685.41
rake 17793 22.7% 30.4 14.89sec 264204 246108 0 0 0 33.9% 1.0% 0.0% 0.0% 179.2 32695 68330 44766 33.9% 0.0% 99.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.36 30.36 179.22 179.22 1.0735 2.4968 8022394.00 8022394.00 0.00 16711.48 246108.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.77 65.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 10.29 33.89% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.18 0.60% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.39% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.5 66.13% 32695.45 27364 52121 32702.18 30661 34836 3875101 3875101 0.00
crit 60.7 33.87% 68330.48 56370 107370 68354.46 64165 74934 4147293 4147293 0.00
DPS Timeline Chart

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<tick_multiplier)
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:Bleeding for $w2 damage every {$t2=3} seconds.
  • description:Rake the target for {$s1=99} Bleed damage and an additional $o2 Bleed damage over {$d=15 seconds}. Awards {$s3=1} combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.300000
  • base_td:98.53
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rip 18039 23.0% 12.7 28.52sec 642341 598404 0 0 0 0.0% 0.8% 0.0% 0.0% 196.0 30300 63324 41519 34.0% 0.0% 86.9%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.67 12.67 196.02 196.02 1.0735 2.0000 8138893.60 8138893.60 0.00 20064.57 598404.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.56 99.15% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.07 0.57% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.28% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.4 66.02% 30299.65 25775 46301 30321.87 27325 35494 3921437 3921437 0.00
crit 66.6 33.98% 63323.96 53096 95380 63289.12 55752 74253 4217457 4217457 0.00
DPS Timeline Chart

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&buff.virmens_bite_potion.up&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<tick_multiplier&target.health.pct<=25&target.time_to_die>30
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every {$t1=2} seconds.
  • description:Finishing move that causes Bleed damage over time. Damage increases per combo point: 1 point : ${$floor({$m1=3}+$b1*1*$<mastery>+0.0484*$AP*$<mastery>)*8} damage over {$d=16 seconds}. 2 points: ${$floor({$m1=3}+$b1*2*$<mastery>+0.0484*2*$AP*$<mastery>)*8} damage over {$d=16 seconds}. 3 points: ${$floor({$m1=3}+$b1*3*$<mastery>+0.0484*3*$AP*$<mastery>)*8} damage over {$d=16 seconds}. 4 points: ${$floor({$m1=3}+$b1*4*$<mastery>+0.0484*4*$AP*$<mastery>)*8} damage over {$d=16 seconds}. 5 points: ${$floor({$m1=3}+$b1*5*$<mastery>+0.0484*5*$AP*$<mastery>)*8} damage over {$d=16 seconds}. Each time you Shred, Ravage, or Mangle the target while in Cat Form the duration of your Rip on that target is extended by {$s2=2} sec, up to a maximum of {$s3=6} sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103000
  • base_td:112.76
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
savage_roar 0 0.0% 15.6 29.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.61 15.61 0.00 0.00 1.0735 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=30}%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
shred 15287 19.4% 130.8 3.45sec 52624 49027 38777 80575 52623 34.0% 1.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.79 130.79 0.00 0.00 1.0734 0.0000 6882568.56 6882568.56 0.00 49026.73 49026.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.04 65.02% 38776.97 28843 51296 38790.09 37709 40087 3297710 3297710 0.00
crit 44.49 34.02% 80575.15 54228 105670 80608.87 76097 84527 3584859 3584859 0.00
dodge 0.72 0.55% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.54 0.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<=4
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing {$m3=500}% damage plus {$m1=1} to the target{$?s48484=false}[ and reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}][]. Must be behind the target. Awards {$s2=1} combo $lpoint:points;. Deals {$62078s2=20}% additional damage against bleeding targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:77.73
  • base_dd_max:77.73
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:5.00
skull_bash 0 0.0% 1.2 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.22 1.22 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:Interrupted.
  • description:You charge and skull bash the target, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}. Increases the mana cost of the victim's spells by {$82365s1=25}% for {$82365d=10 seconds}.
stormlash 694 0.9% 65.4 4.97sec 4708 0 4223 8638 4709 11.9% 0.9% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.41 65.41 0.00 0.00 0.0000 0.0000 307965.71 307965.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.05 87.22% 4223.09 1288 13916 4221.06 3327 5112 240971 240971 0.00
crit 7.76 11.87% 8638.19 2654 28666 8626.42 2654 20408 66994 66994 0.00
miss 0.60 0.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1226.99
  • base_dd_max:1226.99
thrash_cat 1662 2.1% 8.3 49.52sec 90107 83950 9956 20812 13525 33.7% 0.9% 0.0% 0.0% 40.1 11611 24305 15922 34.0% 0.0% 26.6%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 40.05 40.05 1.0734 3.0000 750347.08 750347.08 0.00 5812.54 83950.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.45 65.48% 9955.86 6588 15505 9933.56 0 12533 54288 54288 0.00
crit 2.80 33.66% 20812.11 16028 31940 19715.52 0 31940 58339 58339 0.00
dodge 0.04 0.42% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.44% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.5 66.05% 11611.12 7711 17971 11628.15 10024 14533 307160 307160 0.00
crit 13.6 33.95% 24304.67 15884 37020 24298.23 20649 30928 330561 330561 0.00
DPS Timeline Chart

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.omen_of_clarity.react&dot.thrash_cat.remains<3&buff.dream_of_cenarius_damage.down
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 every {$t2=3} sec.
  • description:Strikes all enemy targets within $A2 yards, dealing ${{$m1=1}+$<mastery>*$AP*{$m3=191}/1000} bleed damage and an additional ${5*({$m2=1}+$<mastery>*$AP*{$m4=141}/1000)} damage over {$d=15 seconds}, and also causing the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by {$115798s1=10}% for {$115798d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.203000
  • base_dd_min:1231.58
  • base_dd_max:1231.58
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.093600
  • base_td:686.40
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
tigers_fury 0 0.0% 15.0 30.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 15.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35&!buff.omen_of_clarity.react
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=6 seconds} and instantly restores {$s2=60} Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.9 0.0 184.8sec 184.8sec 9.58% 9.58%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserk_1:9.58%

Trigger Attempt Success

  • trigger_pct:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 8.83%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bottle_of_infinite_stars 9.6 0.0 49.4sec 49.4sec 41.59% 41.59%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_bottle_of_infinite_stars
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:3236.00

    Stack Uptimes

    • bottle_of_infinite_stars_1:41.59%

    Trigger Attempt Success

    • trigger_pct:15.48%
omen_of_clarity 20.6 0.2 20.9sec 20.7sec 2.49% 6.31%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:4.00%
  • default_value:0.00

Stack Uptimes

  • omen_of_clarity_1:2.49%

Trigger Attempt Success

  • trigger_pct:4.00%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by {$s1=100}%.
  • description:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by {$s1=100}%. Does not affect Nourish.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
predatory_swiftness 27.8 12.5 16.4sec 11.2sec 64.45% 64.45%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • predatory_swiftness_1:64.45%

Trigger Attempt Success

  • trigger_pct:85.21%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth will be instant, free, and castable in all forms.
  • description:Your finishing moves have a chance per combo point to make your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth become instant, free, and castable in all forms.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 7.4 0.0 64.4sec 64.4sec 24.20% 24.20%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.20%

    Trigger Attempt Success

    • trigger_pct:21.33%
savage_roar 0.6 15.0 230.3sec 29.4sec 99.92% 99.88%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • savage_roar_1:99.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=30}%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tigers_fury 15.0 0.0 30.8sec 30.8sec 19.89% 22.94%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:19.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=6 seconds} and instantly restores {$s2=60} Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
virmens_bite_potion 1.0 0.0 386.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Ellimac
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Ellimac
ferocious_bite Energy 38.8 626.3 16.2 32.2 3973.4
rake Energy 30.4 958.2 31.6 31.6 8372.4
rip Energy 12.7 331.4 26.2 26.2 24560.6
savage_roar Energy 16.6 364.4 21.9 23.3 0.0
shred Energy 130.8 4322.8 33.1 33.1 1592.1
thrash_cat Energy 8.3 15.8 1.9 1.9 47565.6
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1803.90 4783.04 (64.50%) 2.65 4.98 0.10%
energy_refund Energy 6.92 46.62 (0.63%) 6.74 0.00 0.00%
lotp_health Health 60.52 0.00 (-nan%) 0.00 1007189.57 100.00%
lotp_mana Mana 60.52 0.00 (-nan%) 0.00 290515.20 100.00%
omen_of_clarity Energy 20.61 874.62 (11.79%) 42.44 0.00 0.00%
soul_of_the_forest Energy 47.41 809.12 (10.91%) 17.07 0.71 0.09%
tigers_fury Energy 15.04 902.22 (12.17%) 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 14.50 14.67
Combat End Resource Mean Min Max
Health 416029.00 416029.00 416029.00
Mana 60000.00 60000.00 60000.00
Rage 0.00 0.00 0.00
Energy 22.12 0.44 90.34
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
symbiosis_wolf-Energy Cap 0.1%

Procs

Count Interval
elemental_force 88.3 5.1sec
primal_fury 54.8 8.2sec
combo_points 214.4 2.8sec
combo_points_wasted 11.0 39.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Ellimac Damage Per Second
Count 999
Mean 78541.89
Minimum 73355.17
Maximum 84538.14
Spread ( max - min ) 11182.97
Range [ ( max - min ) / 2 * 100% ] 7.12%
Standard Deviation 1868.5562
5th Percentile 75393.86
95th Percentile 81597.37
( 95th Percentile - 5th Percentile ) 6203.51
Mean Distribution
Standard Deviation 59.1185
95.00% Confidence Intervall ( 78426.02 - 78657.76 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2174
0.1 Scale Factor Error with Delta=300 29805
0.05 Scale Factor Error with Delta=300 119221
0.01 Scale Factor Error with Delta=300 2980547
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 78541.89
Distribution Chart

Damage

Sample Data
Count 999
Mean 35394345.44
Distribution Chart

DTPS

Sample Data Ellimac Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Ellimac Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Ellimac Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 238.41
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 cat_form
5 0.00 savage_roar
6 0.00 snapshot_stats
7 0.00 virmens_bite_potion
8 0.00 treants,if=talent.force_of_nature.enabled
Default action list
# count action,conditions
9 0.00 run_action_list,name=defaults
actions.defaults
# count action,conditions
A 1.00 auto_attack
B 0.00 faerie_fire,if=debuff.weakened_armor.stack<3
C 0.57 savage_roar,if=buff.savage_roar.down
D 1.22 skull_bash_cat
E 0.00 healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&combo_points>=4&buff.dream_of_cenarius_damage.stack<2
F 0.00 healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&buff.dream_of_cenarius_damage.down
G 0.00 healing_touch,if=talent.dream_of_cenarius.enabled&prev.natures_swiftness
H 15.04 tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
I 2.91 berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
J 0.00 natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
K 0.00 incarnation,if=buff.berserk.up&talent.incarnation.enabled
L 1.54 ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
M 7.91 thrash_cat,if=buff.omen_of_clarity.react&dot.thrash_cat.remains<3&buff.dream_of_cenarius_damage.down
N 3.69 savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0)&target.health.pct<25
O 0.00 natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&target.health.pct<=25
P 1.00 virmens_bite_potion,if=(talent.dream_of_cenarius.enabled&combo_points>=5&target.health.pct<=25&buff.dream_of_cenarius_damage.up)|(!talent.dream_of_cenarius.enabled&buff.berserk.up&target.health.pct<=25)|target.time_to_die<=40
Q 0.00 rip,if=combo_points>=5&buff.virmens_bite_potion.up&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<tick_multiplier&target.health.pct<=25&target.time_to_die>30
R 6.05 ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
S 0.00 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&buff.dream_of_cenarius_damage.up
T 0.00 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<6.0&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<=tick_multiplier&target.health.pct>25
U 10.06 savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0)
V 0.00 natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&dot.rip.remains<3&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)&target.health.pct>25
W 12.67 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
X 0.00 thrash_cat,if=buff.omen_of_clarity.react&dot.thrash_cat.remains<3
Y 0.00 ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
Z 4.15 shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
a 0.42 ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
b 1.28 savage_roar,if=buff.savage_roar.remains<=6&combo_points>=5&(((dot.rip.remains+(8-(dot.rip.ticks_added*2)))>6&(talent.soul_of_the_forest.enabled|buff.berserk.up))|(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>10)&dot.rip.ticking
c 11.46 ferocious_bite,if=combo_points>=5&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>6&dot.rip.ticking&(talent.soul_of_the_forest.enabled|buff.berserk.up)
d 0.00 ferocious_bite,if=combo_points>=5&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>10&dot.rip.ticking
e 0.00 rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<tick_multiplier)
f 30.37 rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
g 0.00 ravage,if=buff.omen_of_clarity.react
h 1.69 shred,if=buff.omen_of_clarity.react
i 0.00 ravage,if=buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
j 0.00 ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
k 0.00 ravage,if=target.time_to_die<=8.5
l 80.95 shred,if=buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
m 20.42 shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
n 1.23 shred,if=target.time_to_die<=8.5
o 0.30 thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&(buff.tigers_fury.up|buff.berserk.up)
p 0.06 thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&cooldown.tigers_fury.remains<=3.0
q 0.06 thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&energy.time_to_max<=1.0
r 0.00 ravage,if=(buff.tigers_fury.up|buff.berserk.up)
s 0.00 ravage,if=cooldown.tigers_fury.remains<=3.0
t 0.00 ravage,if=energy.time_to_max<=1.0
u 9.18 shred,if=(buff.tigers_fury.up|buff.berserk.up)
v 8.30 shred,if=cooldown.tigers_fury.remains<=3.0
w 4.86 shred,if=energy.time_to_max<=1.0
x 0.00 treants,if=talent.force_of_nature.enabled

Sample Sequence

ADfmmMHImWlUllllcfllllMclllWfUlHllcllfUllmWflHlcllfclmUfmmHmmWWlflUwfmmWlHlllcflUllfmWlllHlclfwmWlUfvHIucllllfloUlllmWMfvvHuclfmmWlUfvHuuuffUllmWfllvcHlllcfmmmUfmmHmWlMfwZfWlllHUlflMwRlfMZvRlHIPlflNlllRllllRlfwRlHlflRlllNflmLlHfluRlnna

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 198 189 80
Agility 17907 15607 13933
Stamina 19259 17508 16397
Intellect 273 260 80
Spirit 270 270 80
Health 416029 391515 0
Mana 60000 60000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 289 250 0
Spell Hit 14.06% 14.06% 2408
Spell Crit 14.95% 9.95% 4316
Spell Haste 8.59% 3.42% 1453
ManaReg per Second 300 300 0
Attack Power 39877 449 0
Melee Hit 7.08% 7.08% 2408
Melee Crit 34.69% 27.86% 4316
Melee Haste 3.42% 3.42% 1453
Swing Speed 13.76% 3.42% 1453
Expertise 6.98% 6.98% 2373
Armor 17334 17334 17334
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.95% 0.95% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 67.80% 52.15% 5193

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Ellimac"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Ellimac/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/115/14051187-avatar.jpg"
level=90
race=tauren
spec=feral
role=attack
position=back
professions=skinning=600/leatherworking=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UZ!202010
glyphs=cat_form/savagery/rebirth/aquatic_form/orca/stag

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/cat_form
actions.precombat+=/savage_roar
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/treants,if=talent.force_of_nature.enabled

actions=run_action_list,name=defaults

actions.defaults=auto_attack
actions.defaults+=/faerie_fire,if=debuff.weakened_armor.stack<3
actions.defaults+=/savage_roar,if=buff.savage_roar.down
actions.defaults+=/skull_bash_cat
actions.defaults+=/healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&combo_points>=4&buff.dream_of_cenarius_damage.stack<2
actions.defaults+=/healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&buff.dream_of_cenarius_damage.down
actions.defaults+=/healing_touch,if=talent.dream_of_cenarius.enabled&prev.natures_swiftness
actions.defaults+=/tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
actions.defaults+=/berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
actions.defaults+=/natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
actions.defaults+=/incarnation,if=buff.berserk.up&talent.incarnation.enabled
actions.defaults+=/ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
actions.defaults+=/thrash_cat,if=buff.omen_of_clarity.react&dot.thrash_cat.remains<3&buff.dream_of_cenarius_damage.down
actions.defaults+=/savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0)&target.health.pct<25
actions.defaults+=/natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&target.health.pct<=25
actions.defaults+=/virmens_bite_potion,if=(talent.dream_of_cenarius.enabled&combo_points>=5&target.health.pct<=25&buff.dream_of_cenarius_damage.up)|(!talent.dream_of_cenarius.enabled&buff.berserk.up&target.health.pct<=25)|target.time_to_die<=40
actions.defaults+=/rip,if=combo_points>=5&buff.virmens_bite_potion.up&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<tick_multiplier&target.health.pct<=25&target.time_to_die>30
actions.defaults+=/ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
actions.defaults+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&buff.dream_of_cenarius_damage.up
actions.defaults+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<6.0&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<=tick_multiplier&target.health.pct>25
actions.defaults+=/savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0)
actions.defaults+=/natures_swiftness,if=talent.natures_swiftness.enabled&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&dot.rip.remains<3&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)&target.health.pct>25
actions.defaults+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions.defaults+=/thrash_cat,if=buff.omen_of_clarity.react&dot.thrash_cat.remains<3
actions.defaults+=/ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions.defaults+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions.defaults+=/ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
actions.defaults+=/savage_roar,if=buff.savage_roar.remains<=6&combo_points>=5&(((dot.rip.remains+(8-(dot.rip.ticks_added*2)))>6&(talent.soul_of_the_forest.enabled|buff.berserk.up))|(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>10)&dot.rip.ticking
actions.defaults+=/ferocious_bite,if=combo_points>=5&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>6&dot.rip.ticking&(talent.soul_of_the_forest.enabled|buff.berserk.up)
actions.defaults+=/ferocious_bite,if=combo_points>=5&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>10&dot.rip.ticking
actions.defaults+=/rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<tick_multiplier)
actions.defaults+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions.defaults+=/ravage,if=buff.omen_of_clarity.react
actions.defaults+=/shred,if=buff.omen_of_clarity.react
actions.defaults+=/ravage,if=buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
actions.defaults+=/ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions.defaults+=/ravage,if=target.time_to_die<=8.5
actions.defaults+=/shred,if=buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
actions.defaults+=/shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions.defaults+=/shred,if=target.time_to_die<=8.5
actions.defaults+=/thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&(buff.tigers_fury.up|buff.berserk.up)
actions.defaults+=/thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&cooldown.tigers_fury.remains<=3.0
actions.defaults+=/thrash_cat,if=combo_points>=5&dot.thrash_cat.remains<6&energy.time_to_max<=1.0
actions.defaults+=/ravage,if=(buff.tigers_fury.up|buff.berserk.up)
actions.defaults+=/ravage,if=cooldown.tigers_fury.remains<=3.0
actions.defaults+=/ravage,if=energy.time_to_max<=1.0
actions.defaults+=/shred,if=(buff.tigers_fury.up|buff.berserk.up)
actions.defaults+=/shred,if=cooldown.tigers_fury.remains<=3.0
actions.defaults+=/shred,if=energy.time_to_max<=1.0
actions.defaults+=/treants,if=talent.force_of_nature.enabled

actions.complex=auto_attack
actions.complex+=/heart_of_the_wild,if=talent.heart_of_the_wild.enabled
actions.complex+=/virmens_bite_potion,if=buff.heart_of_the_wild.up|target.time_to_die<=40
actions.complex+=/wrath,if=cast_time<buff.heart_of_the_wild.remains
actions.complex+=/cat_form,if=buff.cat_form.down
actions.complex+=/healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1.5&buff.dream_of_cenarius_damage.down
actions.complex+=/savage_roar,if=buff.savage_roar.down
actions.complex+=/skull_bash_cat
actions.complex+=/healing_touch,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.up&combo_points>=4&buff.dream_of_cenarius_damage.stack<2
actions.complex+=/healing_touch,if=talent.dream_of_cenarius.enabled&prev.natures_swiftness
actions.complex+=/tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
actions.complex+=/berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
actions.complex+=/natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
actions.complex+=/incarnation,if=buff.berserk.up&talent.incarnation.enabled
actions.complex+=/ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
actions.complex+=/faerie_fire,if=debuff.weakened_armor.stack<3
actions.complex+=/thrash_cat,if=target.time_to_die>=6&buff.omen_of_clarity.react&dot.thrash_cat.remains<3&buff.dream_of_cenarius_damage.down
actions.complex+=/ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|(target.time_to_die<=1&combo_points>=3)
actions.complex+=/savage_roar,if=buff.savage_roar.remains<=3&combo_points>0&buff.dream_of_cenarius_damage.down&target.health.pct<25
actions.complex+=/natures_swiftness,if=talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&target.health.pct<=25
actions.complex+=/virmens_bite_potion,if=(talent.dream_of_cenarius.enabled&combo_points>=5&target.health.pct<=25&buff.dream_of_cenarius_damage.up)|(!talent.dream_of_cenarius.enabled&buff.berserk.up&target.health.pct<=25)|target.time_to_die<=40
actions.complex+=/rip,if=combo_points>=5&buff.virmens_bite_potion.up&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<tick_multiplier&target.health.pct<=25&target.time_to_die>30
actions.complex+=/rip,if=combo_points>=5&tick_multiplier%dot.rip.multiplier>1.14&target.health.pct<=25&target.time_to_die>30
actions.complex+=/pool_resource,wait=0.1,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25&((energy<50&buff.berserk.down)|(energy<25&buff.berserk.remains>1))&talent.dream_of_cenarius.enabled
actions.complex+=/ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
actions.complex+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&buff.dream_of_cenarius_damage.up
actions.complex+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<6.0&buff.dream_of_cenarius_damage.up&dot.rip.multiplier<=tick_multiplier&target.health.pct>25
actions.complex+=/natures_swiftness,if=talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&buff.predatory_swiftness.down&combo_points>=5&dot.rip.remains<3&(buff.berserk.up|dot.rip.remains+1.9<=cooldown.tigers_fury.remains)&target.health.pct>25
actions.complex+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains+1.9<=cooldown.tigers_fury.remains)
actions.complex+=/savage_roar,if=buff.savage_roar.remains<=3&combo_points>0&talent.dream_of_cenarius.enabled&buff.savage_roar.remains+2>dot.rip.remains
actions.complex+=/savage_roar,if=buff.savage_roar.remains<=3&combo_points>0&!talent.dream_of_cenarius.enabled&!(dot.rip.remains<2.0&combo_points>=5&(buff.berserk.up|dot.rip.remains+1.9<=cooldown.tigers_fury.remains))
actions.complex+=/thrash_cat,if=target.time_to_die>=6&buff.omen_of_clarity.react&dot.thrash_cat.remains<3
actions.complex+=/ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions.complex+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions.complex+=/savage_roar,if=buff.savage_roar.remains<=6&combo_points>=5&buff.savage_roar.remains+2<=(dot.rip.remains+(8-(dot.rip.ticks_added*2)))
actions.complex+=/pool_resource,wait=0.1,if=talent.dream_of_cenarius.enabled&combo_points>=5&((energy<50&buff.berserk.down)|(energy<25&buff.berserk.remains>1))&buff.savage_roar.remains-6>=(dot.rip.remains+(8-(dot.rip.ticks_added*2)))&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=4.5
actions.complex+=/pool_resource,wait=0.1,if=talent.dream_of_cenarius.enabled&combo_points>=5&((energy<50&buff.berserk.down)|(energy<25&buff.berserk.remains>1))&buff.savage_roar.remains+6>=(dot.rip.remains+(8-(dot.rip.ticks_added*2)))&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=6.5
actions.complex+=/ferocious_bite,if=talent.dream_of_cenarius.enabled&combo_points>=5&buff.savage_roar.remains-6>=(dot.rip.remains+(8-(dot.rip.ticks_added*2)))&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=4
actions.complex+=/ferocious_bite,if=talent.dream_of_cenarius.enabled&combo_points>=5&buff.savage_roar.remains+6>=(dot.rip.remains+(8-(dot.rip.ticks_added*2)))&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=6
actions.complex+=/pool_resource,wait=0.1,if=talent.dream_of_cenarius.enabled&combo_points>=5&((energy<50&buff.berserk.down)|(energy<25&buff.berserk.remains>1))&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=10.5
actions.complex+=/ferocious_bite,if=talent.dream_of_cenarius.enabled&combo_points>=5&(dot.rip.remains+(8-(dot.rip.ticks_added*2)))>=10
actions.complex+=/ferocious_bite,if=combo_points>=5&((dot.rip.remains+(8-(dot.rip.ticks_added*2)))>10|((dot.rip.remains+(8-(dot.rip.ticks_added*2)))>6&buff.berserk.up))&dot.rip.ticking
actions.complex+=/rake,if=target.time_to_die>3&dot.rake.remains<6.0&buff.dream_of_cenarius_damage.up&dot.rake.multiplier<=tick_multiplier
actions.complex+=/rake,if=target.time_to_die-dot.rake.remains>3&tick_multiplier%dot.rake.multiplier>1.12
actions.complex+=/rake,if=target.time_to_die-dot.rake.remains>3&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains|energy>60)
actions.complex+=/ravage,if=buff.omen_of_clarity.react
actions.complex+=/shred,if=buff.omen_of_clarity.react
actions.complex+=/ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions.complex+=/shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions.complex+=/thrash_cat,if=target.time_to_die>=15&dot.thrash_cat.remains<3&buff.berserk.up&talent.soul_of_the_forest.enabled&talent.dream_of_cenarius.enabled
actions.complex+=/ravage,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
actions.complex+=/ravage,if=!talent.dream_of_cenarius.enabled&talent.soul_of_the_forest.enabled&combo_points<5&(energy+(energy.regen*(4-combo_points))>(5-combo_points)*20)
actions.complex+=/ravage,if=target.time_to_die<=8.5
actions.complex+=/shred,if=talent.dream_of_cenarius.enabled&buff.predatory_swiftness.remains>1&!(energy+(energy.regen*(buff.predatory_swiftness.remains-1))<(4-combo_points)*20)
actions.complex+=/shred,if=!talent.dream_of_cenarius.enabled&talent.soul_of_the_forest.enabled&combo_points<5&(energy+(energy.regen*(4-combo_points))>(5-combo_points)*20)
actions.complex+=/shred,if=target.time_to_die<=8.5
actions.complex+=/thrash_cat,if=target.time_to_die>=6&combo_points>=5&dot.thrash_cat.remains<6&(buff.tigers_fury.up|buff.berserk.up|buff.natures_vigil.up)
actions.complex+=/thrash_cat,if=target.time_to_die>=6&combo_points>=5&dot.thrash_cat.remains<6&cooldown.tigers_fury.remains<=3.0
actions.complex+=/thrash_cat,if=target.time_to_die>=6&combo_points>=5&dot.thrash_cat.remains<6&energy.time_to_max<=1.0
actions.complex+=/ravage,if=(buff.tigers_fury.up|buff.berserk.up|buff.natures_vigil.up)
actions.complex+=/ravage,if=cooldown.tigers_fury.remains<=3.0
actions.complex+=/ravage,if=energy.time_to_max<=1.0
actions.complex+=/shred,if=(buff.tigers_fury.up|buff.berserk.up|buff.natures_vigil.up)
actions.complex+=/shred,if=cooldown.tigers_fury.remains<=3.0
actions.complex+=/shred,if=energy.time_to_max<=1.0
actions.complex+=/treants,if=talent.force_of_nature.enabled
actions.complex+=/natures_swiftness,if=buff.natures_vigil.up&!buff.berserk.up&!buff.predatory_swiftness.up
actions.complex+=/healing_touch,if=buff.natures_vigil.up&(buff.predatory_swiftness.up|buff.natures_swiftness.up)&!buff.berserk.up

head=crown_of_opportunistic_strikes,id=86146,gems=agile_primal_160agi_180agi,reforge=haste_mastery
neck=choker_of_the_unleashed_storm,id=86166,reforge=crit_hit
shoulders=netherrealm_shoulderpads,id=85995,gems=160agi_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86173,enchant=180hit
chest=chestguard_of_total_annihilation,id=86136,gems=120agi_60agi_120crit_120agi,enchant=80all,reforge=haste_mastery
shirt=thunder_bluff_doublet,id=45673
tabard=huojin_tabard,id=83080
wrists=quillpaw_family_bracers,id=88884,enchant=500agi,reforge=crit_mastery
hands=malevolent_gladiators_dragonhide_gloves,id=84832,gems=60agi_120hit_60agi,enchant=170exp,reforge=crit_exp
waist=tomb_raiders_girdle,id=85982,gems=60agi_120mastery_60agi_120hit_160agi_120exp,reforge=haste_mastery
legs=stoneflesh_leggings,id=85926,gems=120agi_60agi_120hit_120agi,enchant=285agi_165crit,reforge=crit_mastery
feet=boots_of_raging_haze,id=90914,enchant=140agi,reforge=crit_hit
finger1=seal_of_the_windreaver,id=90861,reforge=hit_mastery
finger2=anjis_keepsake,id=89070,reforge=haste_mastery
trinket1=relic_of_xuen,id=79328
trinket2=bottle_of_infinite_stars,id=86132
main_hand=spear_of_xuen,id=89685,enchant=elemental_force,reforge=crit_exp

# Gear Summary
# gear_strength=80
# gear_agility=13933
# gear_stamina=16397
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2373
# gear_hit_rating=2408
# gear_crit_rating=4316
# gear_haste_rating=1453
# gear_mastery_rating=5193
# gear_armor=17334
# meta_gem=agile_primal
# main_hand=spear_of_xuen,weapon=polearm_3.60speed_9462min_14193max,enchant=elemental_force

Xabiss

Xabiss : 83920 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
83920.3 83920.3 115.78 / 0.14% 3054 / 3.6% 3625.5 10.3 10.2 Focus 0.00% 53.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Xabiss/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Ya!201110
Glyphs
  • deterrence
  • animal_bond
  • marked_for_death
  • revive_pet
  • direction
  • aspect_of_the_cheetah
Professions
  • engineering: 600
  • jewelcrafting: 600

Charts

http://2.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:713344|175061|90812|87089|81698|74658|73624|33854|14565|10791&chds=0,1426689&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,69CCF0,336600,C79C6E&chm=t++713344++stampede,C79C6E,0,0,15|t++175061++dire_beast,C79C6E,1,0,15|t++90812++blink_strike,C79C6E,2,0,15|t++87089++kill_shot,C79C6E,3,0,15|t++81698++glaive_toss,C79C6E,4,0,15|t++74658++serpent_sting,336600,5,0,15|t++73624++kill_command,C79C6E,6,0,15|t++33854++arcane_shot,69CCF0,7,0,15|t++14565++cobra_shot,336600,8,0,15|t++10791++auto_shot,C79C6E,9,0,15&chtt=Xabiss Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:33,31,29,22,17,15,15,15,13,13,8,3,1,1,1,1,1,1,1,1,1,0,0,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,336600,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,336600,336600&chl=cat: melee|cat: kill_command|auto_shot|cat: claw|arcane_shot|dire_beast: dire_beast_melee|glaive_toss|cobra_shot|serpent_sting|cat: blink_strike|kill_shot|stormlash|wolf: melee|hyena: melee|raptor: melee|devilsaur: melee|cat: stormlash|raptor: claw|hyena: claw|wolf: claw|devilsaur: claw|devilsaur: stormlash|wolf: stormlash|raptor: stormlash|hyena: stormlash&chtt=Xabiss Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:87655443433444520zvtqonlkiihfdcaaaZWWVUUUUTTSSTTSTSSSSTSTTTUUUVVVWWVUUUUUUUTTTUUUUTTTTSSSSSTTTTTTTTTSSSRRRRRRSSSSTTTTTTTTTTTTTTUUUUUUUTTTTSSSSSSTTTTTTTTSSTTTTTTUUUUUUTTTTTTTTTTUUVVVVVVVVVVVVVVWWWXXXWWWWVVVVVVVVVWWWVVVUUUTTTTTTTTTTTSSSSRRRRRRRRSSSSSTTTTTTUUUUUUVVVVVVUUUUTTTTSSSSSSSSSSSSSSSSSSSSSTTTTUUUUUUUUVVVWWXXYYYYYYYYXXXXXXXXXXWWWVVVUUUUUUVVVWWWWWWWWWWWWXXXYYYYYYYYYZaabccddeeeefffgggggggfeeeeddcbbaaZYYYXXXXXXXWWWWWWXXXXXXXXXXXXXXXXXXWWWWWWXXXXXYYYYYYYYYYYYYYYXXXXWWWWWWWWWWWWWWXXXXXYYYYXXYYYYYYYYXXXXXXXYYYYYZZZZZYYYYXXXWWWWVVVUUUUUUUUUVUUVVVVVVVVWW&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3886,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=83920|max=215979&chxp=1,1,39,100&chtt=Xabiss DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,1,2,6,5,6,8,9,15,16,19,22,31,28,39,31,42,36,43,34,36,44,45,35,37,37,42,39,29,30,26,29,23,28,22,21,18,11,11,12,7,8,2,3,3,2,2,0,1&chds=0,45&chbh=5&chxt=x&chxl=0:|min=78978|avg=83920|max=89323&chxp=0,1,48,100&chtt=Xabiss DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:37.5,18.4,15.7,6.8,6.6,5.3,3.6,3.3,2.2,0.5&chds=0,100&chdls=ffffff&chco=336600,69CCF0,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cobra_shot 169.2s|arcane_shot 83.2s|kill_command 71.0s|glaive_toss 30.7s|serpent_sting 29.9s|blink_strike 24.0s|kill_shot 16.4s|dire_beast 14.8s|focus_fire 10.0s|stampede 2.1s&chtt=Xabiss Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Xabiss 83920
arcane_shot 6241 7.5% 77.5 5.68sec 36342 33854 28961 60263 36404 24.0% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.47 77.35 0.00 0.00 1.0735 0.0000 2815514.21 2815514.21 0.00 33854.15 33854.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.63 75.81% 28960.90 25938 37993 28969.19 28232 29880 1698100 1698100 0.00
crit 18.54 23.97% 60262.64 53432 78265 60285.02 55946 65264 1117414 1117414 0.00
dodge 0.13 0.16% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes {$m2=100}% weapon damage plus {$m1=1} as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
auto_shot 10774 12.9% 213.2 2.11sec 22782 10791 18113 37715 22815 24.2% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 213.17 212.86 0.00 0.00 2.1112 0.0000 4856275.39 4856275.39 0.00 10790.81 10790.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.02 75.65% 18113.48 16196 24635 18118.62 17629 18456 2916690 2916690 0.00
crit 51.43 24.16% 37714.65 33364 50747 37730.45 36362 39624 1939585 1939585 0.00
dodge 0.27 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.14 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
berserking 0 0.0% 3.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
bestial_wrath 0 0.0% 9.0 52.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.97 8.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.beast_within.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Enraged.
  • description:Send your pet into a rage, causing {$s2=20}% additional damage for {$d=10 seconds} and breaking all effects which cause loss of control of your pet.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][]
blink_strike 0 (4834) 0.0% (5.8%) 22.3 20.43sec 97472 90812 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blink_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 1.0734 0.0000 0.00 0.00 0.00 90811.94 90811.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 22.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blink_strike

Static Values
  • id:130392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:130392
  • name:Blink Strike
  • school:physical
  • tooltip:
  • description:Causes your pet to instantly teleport behind an enemy target up to {$m1=40} yards away from your pet and inflict {$130393s2=6}% normal damage.
cobra_shot 5466 6.5% 109.4 4.01sec 22519 14565 17944 37356 22559 23.9% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.44 109.25 0.00 0.00 1.5461 0.0000 2464429.16 2464429.16 0.00 14565.18 14565.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.89 75.88% 17943.96 16377 23728 17947.15 17577 18303 1487439 1487439 0.00
crit 26.15 23.94% 37355.77 33736 48880 37358.17 35620 40417 976991 976991 0.00
dodge 0.14 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals {$s2=1}% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by {$s3=6} sec. Generates {$91954s1=14} Focus. Useable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (5724) 0.0% (6.8%) 13.8 32.30sec 187896 175061 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.75 13.75 0.00 0.00 1.0734 0.0000 0.00 0.00 0.00 175061.36 175061.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&focus<=90
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=15 seconds}. Each time the beast deals damage, you will gain {$120694s1=5} Focus.
focus_fire 0 0.0% 9.3 45.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.32 9.32 0.00 0.00 1.0734 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring {$s2=6} Focus to your pet and increasing your ranged haste by {$s1=6}% for each Frenzy stack consumed. Lasts for {$d=20 seconds}.
glaive_toss 5571 6.6% 28.6 15.92sec 87717 81698 34808 73101 44072 24.4% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.62 56.96 0.00 0.00 1.0737 0.0000 2510430.86 2510430.86 0.00 81698.48 81698.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.95 75.39% 34808.41 28283 56569 34827.22 32612 37168 1494944 1494944 0.00
crit 13.89 24.39% 73100.85 58263 116531 73116.48 64802 88828 1015487 1015487 0.00
dodge 0.09 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:
  • description:You hurl two glaives toward a target, each dealing {$120761s1=436 to 1309} damage to each enemy struck and reducing movement speed by {$120761s2=30}% for {$120761d=3 seconds}. The primary target will take {$s1=4} times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_command 0 (11600) 0.0% (13.8%) 66.2 6.83sec 79040 73624 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.16 66.16 0.00 0.00 1.0736 0.0000 0.00 0.00 0.00 73624.19 73624.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 66.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:Give the command to kill, causing your pet to instantly inflict $ damage to its target. The pet must be within 25 yards of the target to Kill Command.
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.
kill_shot 3158 3.8% 15.2 5.62sec 93510 87089 74674 155352 94384 24.7% 0.3% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.24 15.10 0.00 0.00 1.0738 0.0000 1425391.72 1425391.72 0.00 87089.37 87089.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.34 75.08% 74673.54 66109 95780 74759.88 69781 79880 846741 846741 0.00
crit 3.72 24.66% 155352.17 136184 197307 153715.65 0 185384 578651 578651 0.00
dodge 0.03 0.17% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish the wounded target off, firing a long range attack dealing {$m2=420}% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every {$90967d=6 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
rapid_fire 0 0.0% 4.6 100.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 4.65 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.rapid_fire.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged haste by $w1{$?s131564=false}[ and PvP Power by $w2][]%.
  • description:Increases ranged haste by {$s1=40}%{$?s131564=false}[ and PvP Power by {$m2=3200}][] for {$d=15 seconds}.
readiness 0 0.0% 1.9 376.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.87 1.87 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 4946 5.9% 27.8 16.52sec 80151 74658 0 0 0 0.0% 1.3% 0.0% 0.0% 134.4 13112 27426 16591 24.3% 0.0% 89.4%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.83 27.77 134.42 134.42 1.0736 3.0000 2230259.31 2230259.31 0.00 5149.00 74658.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.41 98.72% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.33 1.20% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.7 75.69% 13111.70 11212 18863 13115.64 12648 13535 1334098 1334098 0.00
crit 32.7 24.31% 27426.03 23097 38858 27442.75 25913 30580 896162 896162 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes {$118253s1=3240} Nature damage every {$118253t1=3} seconds.
  • description:Causes $118253o1 Nature damage over {$118253d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.160000
  • base_td:3240.38
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (3452) 0.0% (4.1%) 2.0 372.51sec 765775 713344 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0738 0.0000 0.00 0.00 0.00 713344.36 713344.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:
  • description:Summons all of your pets to fight your current target for {$d=20 seconds}. Your pets deal ${100+{$130201m1=-75}}% of their normal damage while summoned this way.
stormlash 1105 1.3% 42.4 7.71sec 11544 0 10575 21536 11544 9.1% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.43 42.43 0.00 0.00 0.0000 0.0000 489765.74 489765.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.48 90.70% 10574.59 4198 23704 10576.30 9053 12246 406882 406882 0.00
crit 3.85 9.07% 21535.86 8648 48830 21079.47 0 45644 82884 82884 0.00
miss 0.10 0.23% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8662.21
  • base_dd_max:8662.21
pet - cat 37482 / 37482
blink_strike 4834 5.8% 22.3 20.43sec 97472 0 74617 152599 97467 34.9% 0.2% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blink_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 0.0000 0.0000 2177851.94 2177851.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.18 41.09% 74616.93 58266 129872 74601.02 58266 90868 685030 685030 0.00
crit 7.81 34.95% 152599.10 116532 259745 153060.32 121795 207046 1191646 1191646 0.00
glance 5.31 23.76% 56731.44 43699 97404 56440.25 0 89307 301177 301177 0.00
dodge 0.02 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blink_strike

Static Values
  • id:130393
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:130393
  • name:Blink Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc130392=Causes your pet to instantly teleport behind an enemy target up to {$m1=40} yards away from your pet and inflict {$130393s2=6}% normal damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:6.00
claw 8207 9.8% 127.8 3.55sec 28931 18386 19702 39846 28931 46.0% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.77 127.77 0.00 0.00 1.5735 0.0000 3696505.55 3696505.55 0.00 18386.00 18386.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.75 53.81% 19702.09 12193 55116 19729.52 17044 23034 1354515 1354515 0.00
crit 58.77 46.00% 39846.09 24387 110231 39899.86 33732 48202 2341990 2341990 0.00
dodge 0.13 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
kill_command 11600 13.8% 66.2 6.83sec 79040 0 58576 118728 79042 34.2% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.16 66.16 0.00 0.00 0.0000 0.0000 5229010.54 5229010.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.39 65.59% 58576.37 46345 104576 58616.56 53970 63391 2541575 2541575 0.00
crit 22.63 34.21% 118727.58 92691 209153 118817.25 107332 132040 2687436 2687436 0.00
dodge 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:697.93
  • base_dd_max:697.93
melee 12466 14.9% 353.7 1.27sec 15869 12460 12200 24948 15869 34.6% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 353.66 353.66 0.00 0.00 1.2736 0.0000 5612296.02 5612296.02 0.00 12460.03 12460.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 145.82 41.23% 12200.09 9711 21645 12208.84 11697 12772 1778988 1778988 0.00
crit 122.25 34.57% 24948.40 19422 43291 24968.06 23588 26437 3050072 3050072 0.00
glance 84.84 23.99% 9231.66 7283 16234 9238.36 8750 9840 783236 783236 0.00
dodge 0.35 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.39 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 5.9 84.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.85 5.85 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 375 0.4% 49.7 6.58sec 3345 0 2604 5344 3345 27.3% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.67 49.67 0.00 0.00 0.0000 0.0000 166156.50 166156.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.02 72.51% 2604.40 1184 8778 2604.34 1889 3258 93809 93809 0.00
crit 13.54 27.25% 5344.16 2368 17556 5333.46 3166 8214 72348 72348 0.00
miss 0.12 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:533.06
  • base_dd_max:533.06
pet - devilsaur 9588 / 861
claw 3271 0.3% 13.8 30.70sec 9470 5998 6894 14052 9471 36.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.76 13.76 0.00 0.00 1.5788 0.0000 130335.69 130335.69 0.00 5998.24 5998.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.77 63.76% 6894.15 3048 11482 6904.91 4936 9679 60498 60498 0.00
crit 4.97 36.11% 14051.69 6097 22965 14054.96 7343 21532 69838 69838 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5774 0.6% 50.8 7.84sec 4529 5897 3393 6998 4529 37.1% 0.2% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.80 50.80 0.00 0.00 0.7680 0.0000 230088.85 230088.85 0.00 5897.14 5897.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.53 38.44% 3393.26 2428 4509 3393.94 2874 3992 66270 66270 0.00
crit 18.87 37.15% 6998.19 4855 9019 6997.18 5717 8111 132066 132066 0.00
glance 12.29 24.20% 2582.82 1821 3382 2584.27 1932 3142 31753 31753 0.00
dodge 0.06 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 8.0 56.11sec 0 0 0 0 0 37.0% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.99 62.74% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.95 37.02% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.01 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:5.60
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for {$d=10 seconds}.
rabid 0 0.0% 2.0 372.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 543 0.1% 25.3 0.59sec 856 0 657 1338 856 29.4% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.29 25.29 0.00 0.00 0.0000 0.0000 21657.89 21657.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.81 70.42% 657.47 296 1829 657.18 435 899 11709 11709 0.00
crit 7.44 29.40% 1337.85 592 3658 1334.04 766 2571 9949 9949 0.00
miss 0.05 0.18% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:705.97
  • base_dd_max:705.97
pet - raptor 9610 / 863
claw 3285 0.3% 13.8 30.71sec 9516 6027 6832 14279 9516 36.2% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.76 13.76 0.00 0.00 1.5789 0.0000 130913.41 130913.41 0.00 6027.04 6027.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.74 63.56% 6832.45 3048 11482 6830.11 4687 9601 59742 59742 0.00
crit 4.98 36.23% 14278.86 6097 22965 14274.16 0 21578 71171 71171 0.00
dodge 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5785 0.6% 50.8 7.84sec 4533 5908 3396 6998 4533 37.2% 0.2% 24.3% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.85 50.85 0.00 0.00 0.7673 0.0000 230508.05 230508.05 0.00 5907.89 5907.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.46 38.28% 3395.91 2428 4509 3397.27 2846 4010 66100 66100 0.00
crit 18.94 37.24% 6997.81 4855 9019 6988.35 5870 8088 132506 132506 0.00
glance 12.37 24.32% 2579.82 1821 3382 2583.15 2050 3158 31902 31902 0.00
dodge 0.04 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 372.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 540 0.1% 25.3 0.59sec 850 0 659 1306 850 29.8% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.31 25.31 0.00 0.00 0.0000 0.0000 21519.28 21519.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 69.96% 658.67 296 1829 659.23 443 919 11665 11665 0.00
crit 7.55 29.81% 1306.10 592 3658 1301.17 805 3197 9854 9854 0.00
miss 0.06 0.23% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2294.41
  • base_dd_max:2294.41
pet - hyena 9616 / 863
cackling_howl 0 0.0% 2.0 372.59sec 0 0 0 0 0 0.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 99.90% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:63.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by {$s1=10}%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by {$s1=10}% for {$d=120 seconds}.
claw 3278 0.3% 13.8 30.71sec 9497 6016 6874 14111 9496 36.4% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.76 13.76 0.00 0.00 1.5787 0.0000 130641.28 130641.28 0.00 6015.62 6015.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.71 63.34% 6874.24 3048 11482 6880.93 4613 11136 59904 59904 0.00
crit 5.01 36.44% 14110.79 6097 22965 14042.09 0 21578 70738 70738 0.00
dodge 0.02 0.15% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5798 0.6% 50.8 7.84sec 4546 5924 3393 7004 4545 37.5% 0.2% 23.7% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.82 50.82 0.00 0.00 0.7675 0.0000 231024.70 231024.70 0.00 5923.56 5923.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.58 38.53% 3393.37 2428 4509 3395.48 2886 4060 66434 66434 0.00
crit 19.05 37.49% 7003.62 4855 9019 6996.38 5828 8002 133455 133455 0.00
glance 12.07 23.75% 2580.00 1821 3382 2578.84 2033 3106 31136 31136 0.00
dodge 0.06 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 372.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 540 0.1% 25.3 0.59sec 851 0 659 1326 851 29.1% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.27 25.27 0.00 0.00 0.0000 0.0000 21510.47 21510.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.85 70.64% 658.74 296 1829 659.23 454 923 11756 11756 0.00
crit 7.36 29.13% 1325.61 592 3658 1319.03 805 3163 9754 9754 0.00
miss 0.06 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:705.97
  • base_dd_max:705.97
pet - wolf 9620 / 864
claw 3278 0.3% 13.8 30.72sec 9496 6014 6860 14178 9494 36.2% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.76 13.76 0.00 0.00 1.5790 0.0000 130631.26 130631.26 0.00 6014.33 6014.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.75 63.59% 6860.16 3048 11482 6858.19 4681 9180 60003 60003 0.00
crit 4.98 36.21% 14178.18 6097 22965 14183.12 0 21578 70628 70628 0.00
dodge 0.02 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5799 0.6% 50.9 7.83sec 4539 5924 3395 7003 4539 37.4% 0.2% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.91 50.91 0.00 0.00 0.7663 0.0000 231079.94 231079.94 0.00 5924.06 5924.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.43 38.16% 3395.15 2428 4509 3398.76 2856 3992 65959 65959 0.00
crit 19.04 37.40% 7003.21 4855 9019 6994.51 5665 8009 133322 133322 0.00
glance 12.33 24.21% 2579.82 1821 3382 2579.30 1931 3174 31799 31799 0.00
dodge 0.06 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 372.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 543 0.1% 25.3 0.59sec 855 0 661 1317 855 29.8% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.31 25.31 0.00 0.00 0.0000 0.0000 21639.55 21639.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.72 70.01% 661.16 296 1829 661.42 460 935 11712 11712 0.00
crit 7.54 29.78% 1317.35 592 3658 1308.07 744 2227 9928 9928 0.00
miss 0.05 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2294.41
  • base_dd_max:2294.41
pet - dire_beast 12871 / 5724
dire_beast_melee 12871 6.8% 126.2 3.37sec 20482 12171 17285 35125 20481 23.9% 0.2% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.16 126.16 0.00 0.00 1.6829 0.0000 2584080.72 2584080.72 0.00 12170.57 12170.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.39 51.83% 17285.09 14812 25915 17287.23 16233 18208 1130256 1130256 0.00
crit 30.13 23.88% 35125.44 29624 51829 35130.66 32568 37999 1058251 1058251 0.00
glance 30.38 24.08% 13020.79 11109 19436 13022.03 11752 13994 395573 395573 0.00
dodge 0.14 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.13 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 9.0 0.0 52.8sec 52.8sec 19.67% 22.93%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_beast_within
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • beast_within_1:19.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:34471
  • name:The Beast Within
  • tooltip:Enraged.
  • description:When your pet is under the effects of Bestial Wrath, you also go into a rage causing {$34471s2=10}% additional damage and reducing Focus costs of all your shots and abilities by {$34471s1=50}% for {$19574d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
berserking 3.0 0.0 181.0sec 181.0sec 6.62% 10.57%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.74%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bottle_of_infinite_stars 9.3 0.0 50.6sec 50.6sec 40.40% 40.40%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_bottle_of_infinite_stars
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:3236.00

    Stack Uptimes

    • bottle_of_infinite_stars_1:40.40%

    Trigger Attempt Success

    • trigger_pct:15.35%
cobra_strikes 9.9 1.7 42.0sec 35.3sec 14.37% 16.36%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • cobra_strikes_1:7.98%
  • cobra_strikes_2:5.08%
  • cobra_strikes_3:0.98%
  • cobra_strikes_4:0.27%
  • cobra_strikes_5:0.05%
  • cobra_strikes_6:0.00%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:{$@spelldesc53260=You have a $h% chance when you hit with Arcane Shot to cause your pet's next 2 Basic Attacks to critically hit. This effect can stack up to 6 times.}
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
focus_fire 9.1 0.2 47.2sec 46.0sec 40.23% 36.87%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • focus_fire_1:40.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring {$s2=6} Focus to your pet and increasing your ranged haste by {$s1=6}% for each Frenzy stack consumed. Lasts for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 15.1 10.8 29.7sec 17.0sec 44.40% 43.02%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:1800.00

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:44.40%

    Trigger Attempt Success

    • trigger_pct:4.91%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by {$s1=1800}.
  • description:Increases agility by {$s1=1800}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 4.6 0.0 100.5sec 100.5sec 15.14% 28.15%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rapid_fire_1:15.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged haste by $w1{$?s131564=false}[ and PvP Power by $w2][]%.
  • description:Increases ranged haste by {$s1=40}%{$?s131564=false}[ and PvP Power by {$m2=3200}][] for {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 6.3 0.0 75.0sec 75.0sec 20.57% 20.57%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:20.57%

    Trigger Attempt Success

    • trigger_pct:22.02%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 7.9 0.0 60.8sec 60.7sec 17.39% 17.39%

Buff details

  • buff initial source:Xabiss
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.39%

    Trigger Attempt Success

    • trigger_pct:100.00%
virmens_bite_potion 1.0 0.0 395.3sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Xabiss
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
cat-bestial_wrath 7.2 0.0 66.2sec 66.2sec 15.83% 17.85%

Buff details

  • buff initial source:Xabiss_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bestial_wrath_1:15.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Enraged.
  • description:Send your pet into a rage, causing {$s2=20}% additional damage for {$d=10 seconds} and breaking all effects which cause loss of control of your pet.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][]
  • max_stacks:
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
cat-frenzy_effect 11.0 39.9 42.3sec 8.8sec 81.62% 82.93%

Buff details

  • buff initial source:Xabiss_cat
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_effect_1:20.30%
  • frenzy_effect_2:20.16%
  • frenzy_effect_3:20.07%
  • frenzy_effect_4:19.72%
  • frenzy_effect_5:1.36%

Trigger Attempt Success

  • trigger_pct:39.80%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
cat-rabid 3.2 0.0 169.3sec 169.3sec 14.13% 22.72%

Buff details

  • buff initial source:Xabiss_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
cat-stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Xabiss_cat
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-frenzy_effect 1.9 3.5 372.6sec 81.2sec 75.25% 75.49%

Buff details

  • buff initial source:Xabiss_devilsaur
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_effect_1:35.01%
  • frenzy_effect_2:23.60%
  • frenzy_effect_3:12.14%
  • frenzy_effect_4:3.77%
  • frenzy_effect_5:0.72%

Trigger Attempt Success

  • trigger_pct:39.73%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 372.6sec 372.6sec 99.82% 96.21%

Buff details

  • buff initial source:Xabiss_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 372.5sec 372.5sec 100.00% 100.00%

Buff details

  • buff initial source:Xabiss_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-stormlash 2.0 0.0 11.0sec 11.0sec 34.73% 34.73%

Buff details

  • buff initial source:Xabiss_devilsaur
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:34.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-frenzy_effect 1.9 3.6 372.2sec 80.3sec 76.36% 76.41%

Buff details

  • buff initial source:Xabiss_hyena
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_effect_1:35.40%
  • frenzy_effect_2:23.88%
  • frenzy_effect_3:12.48%
  • frenzy_effect_4:3.87%
  • frenzy_effect_5:0.73%

Trigger Attempt Success

  • trigger_pct:40.05%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 372.6sec 372.6sec 99.82% 96.21%

Buff details

  • buff initial source:Xabiss_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 372.5sec 372.5sec 100.00% 100.00%

Buff details

  • buff initial source:Xabiss_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-stormlash 2.0 0.0 11.0sec 11.0sec 34.73% 34.73%

Buff details

  • buff initial source:Xabiss_hyena
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:34.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-frenzy_effect 1.9 3.6 372.8sec 79.1sec 75.60% 76.07%

Buff details

  • buff initial source:Xabiss_raptor
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_effect_1:34.93%
  • frenzy_effect_2:23.27%
  • frenzy_effect_3:12.42%
  • frenzy_effect_4:4.07%
  • frenzy_effect_5:0.91%

Trigger Attempt Success

  • trigger_pct:40.25%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 372.6sec 372.6sec 99.82% 96.21%

Buff details

  • buff initial source:Xabiss_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 372.5sec 372.5sec 100.00% 100.00%

Buff details

  • buff initial source:Xabiss_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-stormlash 2.0 0.0 11.0sec 11.0sec 34.73% 34.73%

Buff details

  • buff initial source:Xabiss_raptor
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:34.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-frenzy_effect 1.9 3.7 372.5sec 78.6sec 77.26% 77.35%

Buff details

  • buff initial source:Xabiss_wolf
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_effect_1:34.48%
  • frenzy_effect_2:25.15%
  • frenzy_effect_3:12.51%
  • frenzy_effect_4:4.34%
  • frenzy_effect_5:0.77%

Trigger Attempt Success

  • trigger_pct:40.83%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 372.6sec 372.6sec 99.82% 96.22%

Buff details

  • buff initial source:Xabiss_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 372.5sec 372.5sec 100.00% 100.00%

Buff details

  • buff initial source:Xabiss_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-stormlash 2.0 0.0 11.0sec 11.0sec 34.73% 34.73%

Buff details

  • buff initial source:Xabiss_wolf
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:34.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Xabiss
arcane_shot Focus 77.5 1549.4 20.0 20.0 1817.1
glaive_toss Focus 28.6 378.4 13.2 13.2 6633.5
kill_command Focus 66.2 2326.0 35.2 35.2 2248.1
serpent_sting Focus 27.8 377.8 13.6 13.6 5903.7
pet - cat
claw Focus 127.8 4064.2 31.8 31.8 909.5
pet - devilsaur
claw Focus 13.8 562.0 40.8 40.8 231.9
pet - raptor
claw Focus 13.8 561.8 40.8 40.8 233.0
pet - hyena
claw Focus 13.8 561.8 40.8 40.8 232.5
pet - wolf
claw Focus 13.8 561.7 40.8 40.8 232.6
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1803.90 2192.54 (47.82%) 1.22 143.97 6.16%
invigoration Focus 27.41 449.23 (9.80%) 16.39 98.95 18.05%
cobra_shot Focus 109.05 1345.93 (29.35%) 12.34 180.75 11.84%
dire_beast Focus 125.89 597.57 (13.03%) 4.75 31.89 5.07%
pet - cat
focus_regen Focus 1803.90 2919.46 (73.54%) 1.62 1.19 0.04%
focus_fire Focus 9.32 279.54 (7.04%) 30.00 0.00 0.00%
go_for_the_throat Focus 51.43 770.82 (19.42%) 14.99 0.66 0.09%
pet - devilsaur
focus_regen Focus 159.41 351.75 (100.00%) 2.21 0.56 0.16%
pet - raptor
focus_regen Focus 159.41 351.73 (100.00%) 2.21 0.58 0.17%
pet - hyena
focus_regen Focus 159.41 351.74 (100.00%) 2.21 0.58 0.16%
pet - wolf
focus_regen Focus 159.41 351.72 (100.00%) 2.21 0.60 0.17%
Resource RPS-Gain RPS-Loss
Focus 10.16 10.27
Combat End Resource Mean Min Max
Health 400475.00 400475.00 400475.00
Focus 73.61 6.70 120.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 5.1%
cat-Focus Cap 5.1%
raptor-Focus Cap 5.1%
wolf-Focus Cap 5.1%
dire_beast-Focus Cap 5.1%

Procs

Count Interval
invigoration 27.4 16.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Xabiss Damage Per Second
Count 999
Mean 83920.34
Minimum 78978.29
Maximum 89322.67
Spread ( max - min ) 10344.39
Range [ ( max - min ) / 2 * 100% ] 6.16%
Standard Deviation 1867.0405
5th Percentile 80957.94
95th Percentile 87065.99
( 95th Percentile - 5th Percentile ) 6108.05
Mean Distribution
Standard Deviation 59.0705
95.00% Confidence Intervall ( 83804.56 - 84036.12 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1901
0.1 Scale Factor Error with Delta=300 29757
0.05 Scale Factor Error with Delta=300 119028
0.01 Scale Factor Error with Delta=300 2975713
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 83920.34
Distribution Chart

Damage

Sample Data
Count 999
Mean 16792066.40
Distribution Chart

DTPS

Sample Data Xabiss Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Xabiss Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Xabiss Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 400.86
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 aspect_of_the_hawk
3 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
4 0.00 summon_pet
5 0.00 trueshot_aura
6 0.00 snapshot_stats
7 0.00 virmens_bite_potion
Default action list
# count action,conditions
8 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
9 7.93 use_item,name=hopecrusher_gauntlets
A 1.00 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 9.32 focus_fire,five_stacks=1
D 27.83 serpent_sting,if=!ticking
E 3.00 berserking
F 0.00 fervor,if=enabled&!ticking&focus<=65
G 8.97 bestial_wrath,if=focus>60&!buff.beast_within.up
H 0.00 multi_shot,if=target.adds>5
I 0.00 cobra_shot,if=target.adds>5
J 4.65 rapid_fire,if=!buff.rapid_fire.up
K 2.00 stampede,if=buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
L 15.24 kill_shot
M 66.16 kill_command
N 0.00 a_murder_of_crows,if=enabled&!ticking
O 28.62 glaive_toss,if=enabled
P 0.00 lynx_rush,if=enabled&!dot.lynx_rush.ticking
Q 13.75 dire_beast,if=enabled&focus<=90
R 0.00 barrage,if=enabled
S 0.00 powershot,if=enabled
T 22.34 blink_strike,if=enabled
U 1.87 readiness,wait_for_rapid_fire=1
V 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
W 0.00 focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
X 73.93 cobra_shot,if=dot.serpent_sting.remains<6
Y 77.47 arcane_shot,if=focus>=61|buff.beast_within.up
Z 35.80 cobra_shot

Sample Sequence

9ADEGJKMOTUMOTYYXGMXXXDJYMYYYOYMQCTXXMDYYYYMOZZYXMXXTDYMZOZQMX9XXMDCYTOMGYYYZXMXXDYYMOQYTYMXXCXDMYOYZYMZXTXMXDYOQM9ZZYXMXXDGOMTYYYYMYXXXDMOQZYYMTXXCMDZOYZMZZYXMTXD9EYOMQZZYMXXGXMDJOTYYMYYZZXCMXXDOYMQTYYZMXXXXDMOYYCZMTX9XXMXDOQYMYZGYYXMTXXDMOYZYYMZXXCMDOQTZMZZYXMXXDOYM9ZYYTYMXXXDGMOQYYYMYZTXMXDOYYMZCZZMXXTDOMQYZYYMXXEX9XDMOTYYCMLLXXGXJKDMOULLMOTGYYXMXJLL8DYMYQOYYMLLTXXMDYZLLMOZ9XXMTCDLLMQYOYYMXXLLXDMGTYYOYM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 175 167 80
Agility 17039 14863 13939
Stamina 18148 16498 16347
Intellect 190 181 80
Spirit 194 194 80
Health 400475 377375 0
Focus 120 120 0
Spell Power 0 0 0
Spell Hit 14.79% 14.79% 2528
Spell Crit 12.25% 7.25% 4339
Spell Haste 9.73% 4.50% 1914
ManaReg per Second 0 0 0
Attack Power 43311 29886 0
Melee Hit 7.44% 7.44% 2528
Melee Crit 24.23% 17.50% 4339
Melee Haste 4.50% 4.50% 1914
Swing Speed 14.95% 4.50% 1914
Expertise 7.36% 7.36% 2162
Armor 23378 23378 23378
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 41.04% 31.04% 4514

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Xabiss"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Xabiss/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/16/17202192-avatar.jpg"
level=90
race=troll
spec=beast_mastery
role=attack
position=back
professions=engineering=600/jewelcrafting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!201110
glyphs=deterrence/animal_bond/marked_for_death/revive_pet/direction/aspect_of_the_cheetah

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/aspect_of_the_hawk
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/use_item,name=hopecrusher_gauntlets
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/focus_fire,five_stacks=1
actions+=/serpent_sting,if=!ticking
actions+=/berserking
actions+=/fervor,if=enabled&!ticking&focus<=65
actions+=/bestial_wrath,if=focus>60&!buff.beast_within.up
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/rapid_fire,if=!buff.rapid_fire.up
actions+=/stampede,if=buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
actions+=/kill_shot
actions+=/kill_command
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/glaive_toss,if=enabled
actions+=/lynx_rush,if=enabled&!dot.lynx_rush.ticking
actions+=/dire_beast,if=enabled&focus<=90
actions+=/barrage,if=enabled
actions+=/powershot,if=enabled
actions+=/blink_strike,if=enabled
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
actions+=/cobra_shot,if=dot.serpent_sting.remains<6
actions+=/arcane_shot,if=focus>=61|buff.beast_within.up
actions+=/cobra_shot

head=deadly_retinal_armor,id=77536,gems=agile_primal_600crit_600haste_180agi
neck=choker_of_the_unleashed_storm,id=86166,reforge=crit_hit
shoulders=wingslasher_pauldrons,id=86855,gems=160agi_60agi,enchant=200agi_100crit,reforge=crit_exp
back=blackguard_cape,id=89076,enchant=180hit,addon=goblin_glider,reforge=hit_exp
chest=zorloks_fizzing_chestguard,id=87824,gems=320agi_80agi_160crit_120agi,enchant=80all,reforge=exp_hit
tabard=renowned_guild_tabard,id=69210
wrists=stonemaw_armguards,id=85923,enchant=180agi,reforge=haste_mastery
hands=hopecrusher_gauntlets,id=81074,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_exp
waist=fetters_of_death,id=85993,gems=160agi_160agi_160agi,addon=nitro_boosts,reforge=mastery_exp
legs=subetais_pillaging_leggings,id=86081,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=haste_hit
feet=treads_of_ardent_antagonism,id=90906,enchant=140agi,reforge=crit_exp
finger1=fengs_seal_of_binding,id=89802,reforge=crit_hit
finger2=anjis_keepsake,id=89070,reforge=haste_exp
trinket1=bottle_of_infinite_stars,id=86132
trinket2=relic_of_xuen,id=79328
main_hand=fang_kung_spark_of_titans,id=86142,enchant=lord_blastingtons_scope_of_doom,reforge=crit_hit

# Gear Summary
# gear_strength=80
# gear_agility=13939
# gear_stamina=16347
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2162
# gear_hit_rating=2528
# gear_crit_rating=4339
# gear_haste_rating=1914
# gear_mastery_rating=4514
# gear_armor=23378
# meta_gem=agile_primal
# back=blackguard_cape,addon=goblin_glider
# hands=hopecrusher_gauntlets,addon=synapse_springs_mark_ii
# waist=fetters_of_death,addon=nitro_boosts
# main_hand=fang_kung_spark_of_titans,weapon=bow_3.00speed_8790min_16326max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Khorelle

Khorelle : 65711 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
65710.9 65710.9 81.80 / 0.12% 2164 / 3.3% 5592.4 9.7 9.7 Focus 0.00% 52.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Khorelle/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Yb!201200
Glyphs
  • camouflage
  • animal_bond
  • marked_for_death
  • fetch
  • aspects
  • stampede
Professions
  • alchemy: 600
  • herbalism: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:381813|229459|144257|98029|66940|65125|54568|30269|11953|9243|7260&chds=0,763625&chco=C79C6E,C79C6E,336600,9482C9,C79C6E,C79C6E,C41F3B,69CCF0,336600,C79C6E,C79C6E&chm=t++381813++stampede,C79C6E,0,0,15|t++229459++a_murder_of_crows,C79C6E,1,0,15|t++144257++serpent_sting,336600,2,0,15|t++98029++black_arrow,9482C9,3,0,15|t++66940++kill_shot,C79C6E,4,0,15|t++65125++glaive_toss,C79C6E,5,0,15|t++54568++explosive_shot,C41F3B,6,0,15|t++30269++arcane_shot,69CCF0,7,0,15|t++11953++cobra_shot,336600,8,0,15|t++9243++multi_shot,C79C6E,9,0,15|t++7260++auto_shot,C79C6E,10,0,15&chtt=Khorelle Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:25,13,13,12,11,8,8,7,5,5,4,3,2,1,1,1,1,0,0,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,C79C6E,336600,C79C6E,69CCF0,C79C6E,9482C9,336600,C79C6E,C79C6E,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,336600,336600&chl=explosive_shot|auto_shot|serpent_sting|cat: melee|arcane_shot|glaive_toss|black_arrow|cobra_shot|a_murder_of_crows|cat: claw|kill_shot|improved_serpent_sting|stormlash|wolf: melee|hyena: melee|raptor: melee|devilsaur: melee|cat: stormlash|raptor: claw|wolf: claw|hyena: claw|devilsaur: claw|multi_shot|hyena: stormlash|devilsaur: stormlash|wolf: stormlash|raptor: stormlash&chtt=Khorelle Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:tvwyz0000113575776541zxvtsqonmkjihgfedccbbaaaaZZZaZZZYYXXXXXXXXYYZZZZZYYYYYXXXXXXXXYXXXXXXXXXYYYZZZZZZYYXXXXWWWWWWWWWWWWWWWWWWWXXXXXXXWXXWWWWWWWWWWVVVVUUUTUTTTTUUUUVVVVWWWXXYZZZaaabbbbbcbccccccccbbbbaaaZZZYYYXXXXXXXWWWWWWWWWWWWWWVVVVVVVVWWWWWWWWWWWWXXXXXXXXXWWWWVVVVVVVWWWWXXYYYXYXXYYYZZZZZaZZZZZZaaabbbcccccccccccccccbcbbbbaaZZZZYYXXXXXXXXXXXXXWXXXXXXYYYZZZaaaabbccddeeefffeeeeeeeeeedddddcdddddeeeeffffffffffffffffeeeeeeededddddddcccccbbbbbbbbbbbbbbbccccddeeeeeeeeeeeddddddddddccccbbbbccccccccbbbbaaaaaaaaaZZZZZZYYYYYYYYYYYZZZZZZZZZZZZaabbbbbcccccddddeeef&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4521,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=65711|max=145349&chxp=1,1,45,100&chtt=Khorelle DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,2,2,1,4,6,8,12,10,15,14,26,17,29,29,33,25,29,29,43,44,39,53,43,54,47,45,34,34,35,49,36,29,21,16,20,13,10,8,5,6,7,6,1,3,1,1,1,2&chds=0,54&chbh=5&chxt=x&chxl=0:|min=61930|avg=65711|max=69671&chxp=0,1,49,100&chtt=Khorelle DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.7,25.0,20.3,7.0,5.9,4.2,3.2,1.3,0.9,0.5&chds=0,100&chdls=ffffff&chco=336600,C41F3B,69CCF0,C79C6E,336600,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=cobra_shot 143.2s|explosive_shot 112.8s|arcane_shot 91.6s|glaive_toss 31.8s|serpent_sting 26.7s|black_arrow 18.8s|kill_shot 14.5s|a_murder_of_crows 5.7s|multi_shot 3.9s|stampede 2.1s&chtt=Khorelle Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Khorelle 65711
a_murder_of_crows 2898 4.4% 5.3 112.77sec 246336 229459 0 0 0 0.0% 0.0% 0.0% 0.0% 151.8 7254 14974 9078 23.6% 0.0% 33.6%

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.30 5.30 151.76 143.78 1.0737 1.0000 1305162.99 1305162.99 0.00 8289.28 229459.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.8 76.38% 7254.03 5819 11385 7258.93 6792 7794 796597 796597 0.00
crit 34.0 23.62% 14973.61 11639 22769 14989.23 13559 16639 508566 508566 0.00
DPS Timeline Chart

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled&!ticking
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=30 seconds}. If used on a target below 20% health, the cooldown is reduced to {$s1=60} seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:30
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:2.1000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=561} physical damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.206000
  • base_dd_min:560.83
  • base_dd_max:560.83
arcane_shot 6151 9.4% 85.3 5.16sec 32496 30269 26425 53315 32530 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.33 85.24 0.00 0.00 1.0736 0.0000 2773005.29 2773005.29 0.00 30269.35 30269.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.88 77.29% 26425.32 24573 33880 26428.79 25744 27287 1741035 1741035 0.00
crit 19.36 22.71% 53315.14 49146 67760 53321.48 50534 57138 1031970 1031970 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes {$m2=100}% weapon damage plus {$m1=1} as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
arcane_torrent 0 0.0% 4.3 120.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
auto_shot 7246 11.0% 186.3 2.41sec 17534 7260 14186 28766 17558 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.32 186.06 0.00 0.00 2.4152 0.0000 3266948.50 3266948.50 0.00 7259.89 7259.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.02 76.87% 14185.57 12930 18719 14189.70 13943 14497 2028780 2028780 0.00
crit 43.04 23.13% 28765.50 25860 37438 28779.53 27498 30199 1238168 1238168 0.00
DPS Timeline Chart

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 4088 6.2% 17.5 25.59sec 105227 98029 0 0 0 23.6% 0.0% 0.0% 0.0% 173.0 8559 17590 10648 23.1% 0.0% 76.7%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.51 17.51 173.03 173.03 1.0734 2.0000 1842364.38 1842364.38 0.00 5049.73 98029.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.37 76.39% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.13 23.61% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.0 76.87% 8559.29 6992 13949 8566.76 8024 9239 1138517 1138517 0.00
crit 40.0 23.13% 17589.96 13985 27898 17601.94 15719 19790 703848 703848 0.00
DPS Timeline Chart

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.time_to_die>=8
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:{$s1=143} Shadow damage every {$t1=2} seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.115000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
cobra_shot 3793 5.8% 84.0 5.26sec 20364 11953 16486 33448 20415 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.03 83.82 0.00 0.00 1.7037 0.0000 1711224.37 1711224.37 0.00 11952.90 11952.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.41 76.84% 16485.95 15139 21654 16491.34 16034 17055 1061789 1061789 0.00
crit 19.42 23.16% 33447.84 30278 43308 33450.20 30278 36687 649435 649435 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals {$s2=1}% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by {$s3=6} sec. Generates {$91954s1=14} Focus. Useable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
explosive_shot 13650 20.8% 105.1 4.26sec 58573 54568 15829 32393 19653 23.1% 0.0% 0.0% 0.0% 192.9 17137 34988 21222 22.9% 0.0% 42.8%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.07 104.85 192.88 192.88 1.0734 1.0000 6154233.94 6154233.94 0.00 20134.12 54568.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.64 76.91% 15828.58 13097 26127 15836.88 15101 16713 1276462 1276462 0.00
crit 24.21 23.09% 32393.05 26194 52253 32415.79 29024 36092 784348 784348 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.7 77.11% 17136.65 13097 43544 17142.85 16149 18329 2548865 2548865 0.00
crit 44.1 22.89% 34987.94 26194 87088 35001.35 31721 39827 1544558 1544558 0.00
DPS Timeline Chart

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lock_and_load.react
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${({$m1=1}+$M1)/2+$RAP*{$m3=280}/1000} Fire damage initially and every second for {$d=2 seconds}$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.280000
  • base_dd_min:174.48
  • base_dd_max:523.45

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${({$m1=1}+$M1)/2+$RAP*{$m3=280}/1000} Fire damage initially and every second for {$d=2 seconds}$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:false
  • direct_power_mod:0.280000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13097.03
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
glaive_toss 4594 7.0% 29.6 15.46sec 69913 65125 28244 57907 35108 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.61 58.96 0.00 0.00 1.0735 0.0000 2069814.38 2069814.38 0.00 65125.37 65125.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.32 76.87% 28243.90 23571 45183 28262.37 26579 30308 1279990 1279990 0.00
crit 13.64 23.13% 57906.71 47142 90366 57981.52 50337 74389 789825 789825 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:
  • description:You hurl two glaives toward a target, each dealing {$120761s1=436 to 1309} damage to each enemy struck and reducing movement speed by {$120761s2=30}% for {$120761d=3 seconds}. The primary target will take {$s1=4} times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
improved_serpent_sting 1464 2.2% 28.5 15.81sec 23174 0 18655 37960 23174 23.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: improved_serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.48 28.48 0.00 0.00 0.0000 0.0000 659891.45 659891.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.81 76.60% 18655.15 16338 27038 18663.37 17464 19959 406880 406880 0.00
crit 6.66 23.40% 37959.88 32675 54075 37932.39 0 49116 253011 253011 0.00
DPS Timeline Chart

Action details: improved_serpent_sting

Static Values
  • id:82834
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:82834
  • name:Improved Serpent Sting
  • school:physical
  • tooltip:
  • description:Increases the damage of your Serpent Sting by {$s2=50}%, and causes it to also deal instant damage equal to {$s1=15}% of its total periodic effect.
kill_shot 2153 3.3% 13.5 6.26sec 71858 66940 58589 118851 72637 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.55 13.40 0.00 0.00 1.0735 0.0000 973638.48 973638.48 0.00 66939.74 66939.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.28 76.69% 58588.63 52745 75438 58622.97 53518 64607 602314 602314 0.00
crit 3.12 23.31% 118850.66 105490 150875 113909.47 0 150875 371324 371324 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish the wounded target off, firing a long range attack dealing {$m2=420}% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every {$90967d=6 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lifeblood 0 0.0% 4.3 120.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lifeblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lifeblood

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
multi_shot 80 0.1% 3.6 80.82sec 9925 9243 8200 16595 10061 22.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: multi_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.64 3.59 0.00 0.00 1.0738 0.0000 36132.00 36132.00 0.00 9243.29 9243.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.80 77.84% 8199.50 7533 10775 7688.79 0 9782 22925 22925 0.00
crit 0.80 22.16% 16595.42 15066 21550 8903.11 0 21550 13207 13207 0.00
DPS Timeline Chart

Action details: multi_shot

Static Values
  • id:2643
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:2643
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and all enemies within $A2 yards of that target for {$m2=60}% of weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.60
rapid_fire 0 0.0% 4.5 102.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.52 4.52 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.rapid_fire.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged haste by $w1{$?s131564=false}[ and PvP Power by $w2][]%.
  • description:Increases ranged haste by {$s1=40}%{$?s131564=false}[ and PvP Power by {$m2=3200}][] for {$d=15 seconds}.
readiness 0 0.0% 1.8 383.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.80 1.80 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 7080 (8544) 10.8% (13.0%) 28.5 15.82sec 135333 144257 0 0 0 0.0% 0.0% 0.0% 0.0% 132.7 19432 39511 24064 23.1% 0.0% 88.3%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.48 28.48 132.72 132.72 0.9382 3.0000 3193776.90 3193776.90 0.00 9069.85 144256.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.1 76.94% 19432.45 17052 28221 19439.49 18806 20184 1984395 1984395 0.00
crit 30.6 23.06% 39511.09 34105 56441 39526.57 36728 43310 1209382 1209382 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes {$118253s1=3240} Nature damage every {$118253t1=3} seconds.
  • description:Causes $118253o1 Nature damage over {$118253d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.160000
  • base_td:3240.38
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (1843) 0.0% (2.8%) 2.0 376.36sec 409685 381813 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0733 0.0000 0.00 0.00 0.00 381812.70 381812.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:
  • description:Summons all of your pets to fight your current target for {$d=20 seconds}. Your pets deal ${100+{$130201m1=-75}}% of their normal damage while summoned this way.
stormlash 1177 1.8% 46.6 7.00sec 11178 0 10056 20162 11178 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.63 46.63 0.00 0.00 0.0000 0.0000 521218.00 521218.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.46 88.90% 10056.31 3972 23294 10054.27 8234 12004 416910 416910 0.00
crit 5.18 11.10% 20162.42 7945 46588 19957.14 0 46588 104308 104308 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3728.21
  • base_dd_max:3728.21
pet - cat 9493 / 9493
claw 2763 4.2% 101.5 4.48sec 12265 7795 9067 18674 12264 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.46 101.46 0.00 0.00 1.5735 0.0000 1244321.12 1244321.12 0.00 7794.64 7794.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.69 66.72% 9067.12 7090 28444 9078.69 8285 10175 613739 613739 0.00
crit 33.77 33.28% 18673.56 14181 56889 18700.67 16217 23008 630582 630582 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 6546 10.0% 329.7 1.37sec 8942 6546 6918 14213 8942 33.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 329.71 329.71 0.00 0.00 1.3659 0.0000 2948340.89 2948340.89 0.00 6546.47 6546.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.03 42.77% 6917.54 5683 11196 6922.13 6561 7295 975593 975593 0.00
crit 109.60 33.24% 14212.80 11366 22393 14223.63 13411 15351 1557802 1557802 0.00
glance 79.08 23.98% 5247.00 4262 8397 5250.37 4865 5664 414947 414947 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 184 0.3% 44.3 7.38sec 1836 0 1430 3009 1836 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.33 44.33 0.00 0.00 0.0000 0.0000 81415.37 81415.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.91 74.24% 1429.56 685 4523 1429.58 1131 1840 47050 47050 0.00
crit 11.42 25.76% 3008.76 1370 9047 3002.19 1721 4988 34365 34365 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:497.09
  • base_dd_max:497.09
pet - devilsaur 5237 / 460
claw 1773 0.2% 13.4 31.73sec 5149 3261 3702 7763 5149 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.5789 0.0000 69197.64 69197.64 0.00 3261.27 3261.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.65 64.36% 3701.71 1773 7111 3708.99 2303 5528 32020 32020 0.00
crit 4.79 35.64% 7762.61 3545 14222 7751.52 0 14222 37177 37177 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3162 0.4% 46.1 8.71sec 2676 3221 2011 4181 2677 35.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.14 46.14 0.00 0.00 0.8308 0.0000 123500.58 123500.58 0.00 3221.45 3221.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.56 40.23% 2011.31 1421 2799 2013.80 1565 2506 37331 37331 0.00
crit 16.54 35.84% 4181.29 2842 5598 4184.10 3327 5215 69149 69149 0.00
glance 11.04 23.93% 1541.22 1066 2099 1542.13 1157 1980 17020 17020 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 5.9 80.59sec 0 0 0 0 0 35.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.88 5.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.81 64.87% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.07 35.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for {$d=10 seconds}.
rabid 0 0.0% 2.0 376.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 303 0.0% 25.2 0.65sec 469 0 363 748 469 27.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.18 25.18 0.00 0.00 0.0000 0.0000 11801.55 11801.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.27 72.59% 363.41 171 1131 358.87 203 481 6642 6642 0.00
crit 6.90 27.41% 747.82 343 2262 734.94 0 1890 5160 5160 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.22
  • base_dd_max:539.22
pet - raptor 5253 / 461
claw 1788 0.2% 13.4 31.73sec 5194 3290 3661 7904 5193 36.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.5786 0.0000 69794.05 69794.05 0.00 3290.00 3290.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.58 63.88% 3660.93 1773 7111 3668.10 2130 5390 31426 31426 0.00
crit 4.85 36.12% 7904.33 3545 14222 7920.92 0 14222 38368 38368 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3164 0.4% 46.1 8.71sec 2678 3224 2007 4199 2678 35.8% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.14 46.14 0.00 0.00 0.8309 0.0000 123585.21 123585.21 0.00 3223.57 3223.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.42 39.93% 2007.31 1421 2799 2009.12 1637 2420 36980 36980 0.00
crit 16.53 35.83% 4198.66 2842 5598 4199.30 3241 5022 69422 69422 0.00
glance 11.19 24.24% 1536.20 1066 2099 1535.79 1151 1908 17184 17184 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 376.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 302 0.0% 25.2 0.65sec 467 0 364 746 467 27.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.18 25.18 0.00 0.00 0.0000 0.0000 11748.53 11748.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.39 73.04% 363.71 171 1131 358.96 189 471 6689 6689 0.00
crit 6.79 26.96% 745.55 343 2262 731.64 0 1890 5060 5060 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.22
  • base_dd_max:539.22
pet - hyena 5245 / 461
cackling_howl 0 0.0% 2.0 376.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by {$s1=10}%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by {$s1=10}% for {$d=120 seconds}.
claw 1775 0.2% 13.4 31.73sec 5154 3264 3678 7850 5154 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.5790 0.0000 69274.58 69274.58 0.00 3264.28 3264.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.68 64.61% 3677.92 1773 7111 3689.26 2178 5726 31942 31942 0.00
crit 4.76 35.39% 7849.99 3545 14222 7875.64 0 14222 37333 37333 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3167 0.4% 46.1 8.72sec 2680 3226 2003 4205 2680 35.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.14 46.14 0.00 0.00 0.8309 0.0000 123673.38 123673.38 0.00 3225.79 3225.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.57 40.25% 2003.40 1421 2799 2006.57 1597 2361 37208 37208 0.00
crit 16.52 35.80% 4205.44 2842 5598 4200.12 3332 5033 69473 69473 0.00
glance 11.05 23.95% 1537.75 1066 2099 1537.17 1137 1951 16993 16993 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 376.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 303 0.0% 25.2 0.65sec 469 0 364 743 469 27.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.18 25.18 0.00 0.00 0.0000 0.0000 11817.97 11817.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.20 72.27% 364.29 171 1131 359.46 203 484 6629 6629 0.00
crit 6.98 27.73% 742.99 343 2262 730.74 0 1890 5189 5189 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.22
  • base_dd_max:539.22
pet - wolf 5250 / 461
claw 1779 0.2% 13.4 31.72sec 5164 3271 3682 7830 5165 35.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.5789 0.0000 69426.67 69426.67 0.00 3270.83 3270.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.64 64.27% 3682.44 1773 7111 3690.55 2137 5535 31815 31815 0.00
crit 4.80 35.73% 7829.59 3545 14222 7794.62 0 13239 37611 37611 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3168 0.4% 46.1 8.71sec 2682 3228 2008 4197 2682 35.9% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.15 46.15 0.00 0.00 0.8309 0.0000 123755.12 123755.12 0.00 3227.92 3227.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.54 40.18% 2008.46 1421 2799 2010.34 1647 2440 37238 37238 0.00
crit 16.58 35.93% 4197.05 2842 5598 4198.94 3443 5095 69592 69592 0.00
glance 11.02 23.89% 1535.62 1066 2099 1536.46 1189 1951 16925 16925 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 376.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
stormlash 303 0.0% 25.2 0.65sec 469 0 362 752 469 27.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.17 25.17 0.00 0.00 0.0000 0.0000 11794.75 11794.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.32 72.77% 362.43 171 1131 357.67 194 490 6639 6639 0.00
crit 6.85 27.23% 751.98 343 2262 734.78 0 1732 5156 5156 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.22
  • base_dd_max:539.22

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 15.95%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
flashing_steel_talisman 5.5 0.0 90.7sec 90.7sec 17.94% 17.94%

Buff details

  • buff initial source:Khorelle
  • cooldown name:flashing_steel_talisman_trinket1
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:4232.00

    Stack Uptimes

    • flashing_steel_talisman_1:17.94%

    Trigger Attempt Success

    • trigger_pct:100.00%
lifeblood 4.3 0.0 120.7sec 120.7sec 18.64% 18.64%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_lifeblood
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:2880.00

    Stack Uptimes

    • lifeblood_1:18.64%

    Trigger Attempt Success

    • trigger_pct:100.00%
lock_and_load 20.9 0.0 20.9sec 20.9sec 10.88% 39.63%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:12.00
  • cooldown:10.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:5.02%
  • lock_and_load_2:5.86%

Trigger Attempt Success

  • trigger_pct:20.20%

Spelldata details

  • id:56453
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown and costs no Focus.
  • description:{$@spelldesc56343=You have a $h% chance when you trap a target with Freezing Trap or Ice Trap, and a {$s1=20}% chance when your Black Arrow or Explosive Trap deals damage to cause your next two Explosive Shots to cost no Focus and trigger no cooldown. Effect lasts for {$56453d=12 seconds} and cannot occur more often than once every {$s2=10} sec.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
lord_blastingtons_scope_of_doom 16.3 21.1 27.8sec 11.9sec 56.27% 57.59%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:1800.00

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:56.27%

    Trigger Attempt Success

    • trigger_pct:4.86%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by {$s1=1800}.
  • description:Increases agility by {$s1=1800}.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 4.5 0.0 102.9sec 102.9sec 14.68% 26.46%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rapid_fire_1:14.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged haste by $w1{$?s131564=false}[ and PvP Power by $w2][]%.
  • description:Increases ranged haste by {$s1=40}%{$?s131564=false}[ and PvP Power by {$m2=3200}][] for {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 6.7 0.0 70.9sec 70.9sec 22.03% 22.03%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:22.03%

    Trigger Attempt Success

    • trigger_pct:21.33%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 48.1 8.8 9.2sec 7.8sec 18.90% 63.49%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:16.05%
  • thrill_of_the_hunt_2:2.59%
  • thrill_of_the_hunt_3:0.26%

Trigger Attempt Success

  • trigger_pct:30.11%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a $h% chance when you fire a ranged attack that costs Focus or Kill Command to reduce the Focus cost of your next {$s1=3} Arcane Shots or Multi-Shots by {$34720s1=20}.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
virmens_bite_potion 1.0 0.0 395.3sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Khorelle
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
cat-rabid 4.3 0.0 120.3sec 120.3sec 18.72% 29.57%

Buff details

  • buff initial source:Khorelle_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:18.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
cat-stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Khorelle_cat
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 376.4sec 376.4sec 99.81% 95.83%

Buff details

  • buff initial source:Khorelle_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 376.4sec 376.4sec 100.00% 100.00%

Buff details

  • buff initial source:Khorelle_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-stormlash 1.8 0.0 11.0sec 11.0sec 39.49% 39.49%

Buff details

  • buff initial source:Khorelle_devilsaur
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:39.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 376.4sec 376.4sec 99.81% 95.83%

Buff details

  • buff initial source:Khorelle_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 376.4sec 376.4sec 100.00% 100.00%

Buff details

  • buff initial source:Khorelle_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-stormlash 1.8 0.0 11.0sec 11.0sec 39.49% 39.49%

Buff details

  • buff initial source:Khorelle_hyena
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:39.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 376.4sec 376.4sec 99.81% 95.83%

Buff details

  • buff initial source:Khorelle_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 376.4sec 376.4sec 100.00% 100.00%

Buff details

  • buff initial source:Khorelle_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-stormlash 1.8 0.0 11.0sec 11.0sec 39.49% 39.49%

Buff details

  • buff initial source:Khorelle_raptor
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:39.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 376.4sec 376.4sec 99.81% 95.83%

Buff details

  • buff initial source:Khorelle_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rabid_1:99.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack speed increased by {$s1=70}%.
  • description:Increases your pet's attack speed by {$s1=70}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 376.4sec 376.4sec 100.00% 100.00%

Buff details

  • buff initial source:Khorelle_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stampede_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-stormlash 1.8 0.0 11.0sec 11.0sec 39.49% 39.49%

Buff details

  • buff initial source:Khorelle_wolf
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:39.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Khorelle
a_murder_of_crows Focus 5.3 317.9 60.0 60.0 4105.8
arcane_shot Focus 85.3 924.9 10.8 10.8 2998.1
black_arrow Focus 17.5 612.8 35.0 35.0 3006.6
explosive_shot Focus 105.1 1582.8 15.1 15.1 3888.1
glaive_toss Focus 29.6 444.1 15.0 15.0 4660.8
multi_shot Focus 3.6 72.8 20.0 20.0 496.5
serpent_sting Focus 28.5 427.1 15.0 15.0 9023.0
pet - cat
claw Focus 101.5 2636.4 26.0 26.0 472.0
pet - devilsaur
claw Focus 13.4 486.0 36.2 36.2 142.4
pet - raptor
claw Focus 13.4 485.9 36.2 36.2 143.6
pet - hyena
claw Focus 13.4 486.0 36.2 36.2 142.5
pet - wolf
claw Focus 13.4 486.1 36.2 36.2 142.8
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.29 35.58 (0.82%) 8.29 28.80 44.74%
focus_regen Focus 1803.90 1840.46 (42.26%) 1.02 200.95 9.84%
thrill_of_the_hunt Focus 56.64 1127.83 (25.90%) 19.91 77.71 6.45%
cobra_shot Focus 83.83 994.21 (22.83%) 11.86 179.41 15.29%
viper_venom Focus 132.72 356.69 (8.19%) 2.69 41.48 10.42%
pet - cat
focus_regen Focus 1803.90 2551.76 (100.00%) 1.41 0.00 0.00%
pet - devilsaur
focus_regen Focus 156.47 312.20 (100.00%) 2.00 0.47 0.15%
pet - raptor
focus_regen Focus 156.47 312.18 (100.00%) 2.00 0.50 0.16%
pet - hyena
focus_regen Focus 156.47 312.19 (100.00%) 2.00 0.49 0.16%
pet - wolf
focus_regen Focus 156.47 312.21 (100.00%) 2.00 0.46 0.15%
Resource RPS-Gain RPS-Loss
Focus 9.65 9.71
Combat End Resource Mean Min Max
Health 355633.00 355633.00 355633.00
Focus 72.52 0.19 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 9.8%
cat-Focus Cap 9.8%
raptor-Focus Cap 9.8%
wolf-Focus Cap 9.8%
dire_beast-Focus Cap 9.8%

Procs

Count Interval
thrill_of_the_hunt 56.9 7.8sec
lock_and_load 20.9 20.9sec
explosive_shot_focus_starved 9.1 75.1sec
black_arrow_focus_starved 7.6 59.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Khorelle Damage Per Second
Count 999
Mean 65710.93
Minimum 61930.44
Maximum 69670.69
Spread ( max - min ) 7740.25
Range [ ( max - min ) / 2 * 100% ] 5.89%
Standard Deviation 1319.1974
5th Percentile 63497.43
95th Percentile 67825.33
( 95th Percentile - 5th Percentile ) 4327.90
Mean Distribution
Standard Deviation 41.7376
95.00% Confidence Intervall ( 65629.13 - 65792.73 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1548
0.1 Scale Factor Error with Delta=300 14856
0.05 Scale Factor Error with Delta=300 59424
0.01 Scale Factor Error with Delta=300 1485604
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 65710.93
Distribution Chart

Damage

Sample Data
Count 999
Mean 24507410.68
Distribution Chart

DTPS

Sample Data Khorelle Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Khorelle Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Khorelle Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 393.65
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 aspect_of_the_hawk
3 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
4 0.00 summon_pet
5 0.00 trueshot_aura
6 0.00 snapshot_stats
7 0.00 virmens_bite_potion
Default action list
# count action,conditions
8 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
9 4.29 arcane_torrent
A 5.48 use_item,name=flashing_steel_talisman
B 4.29 lifeblood
C 1.00 auto_shot
D 0.00 explosive_trap,if=target.adds>0
E 5.30 a_murder_of_crows,if=enabled&!ticking
F 0.00 blink_strike,if=enabled
G 0.00 lynx_rush,if=enabled&!dot.lynx_rush.ticking
H 40.13 explosive_shot,if=buff.lock_and_load.react
I 29.61 glaive_toss,if=enabled
J 0.00 powershot,if=enabled
K 0.00 barrage,if=enabled
L 0.00 multi_shot,if=target.adds>2
M 0.00 cobra_shot,if=target.adds>2
N 24.88 serpent_sting,if=!ticking&target.time_to_die>=10
O 64.94 explosive_shot,if=cooldown_react
P 13.55 kill_shot
Q 17.51 black_arrow,if=!ticking&target.time_to_die>=8
R 3.64 multi_shot,if=buff.thrill_of_the_hunt.react&dot.serpent_sting.remains<2
S 38.71 arcane_shot,if=buff.thrill_of_the_hunt.react
T 4.52 rapid_fire,if=!buff.rapid_fire.up
U 0.00 dire_beast,if=enabled
V 2.00 stampede,if=buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
W 1.80 readiness,wait_for_rapid_fire=1
X 0.00 fervor,if=enabled&focus<=50
Y 49.10 cobra_shot,if=dot.serpent_sting.remains<6
Z 46.61 arcane_shot,if=focus>=67
a 35.29 cobra_shot

Sample Sequence

9ABCEINSOSQTVWIOSaYYYOYNZHHOSITZZQOYYEYHHNOaaIZaOZaYYONQaIOSZaHHOYRNSOISSSZOQSaYOYINASOSHHOZZZYOYINQOSSaHHOYSY9BINHHOZaZZQOYHHINOSaaZOaYYEINOSQaaHHOSYIYHHNOSSZZAZOQSIYHHONSZZaOHHIOYYTYNOQaaZZIOSSYHHONZZaOaIZQYOYY9BNSOZZIOHOSYYYONQSZIOSZZaAOHEOYNSIOaaQaOYYYINOZHHOaZZYOYINQOSaZZOaYYHHINOSSZZZOQSYYIHHNOSZZZZOaYIAS9BOQNaHHOaPPZISHHONZaPOPQTVWIOPPYY8EHHNOSPPITaOQSYYYHHNOPPISSOSSYYHHNOPIPQaOSYYYOAHHIO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 171 163 80
Agility 13900 11537 10771
Stamina 14945 13586 13435
Intellect 197 188 80
Spirit 191 191 80
Health 355633 336607 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.33% 15.33% 2636
Spell Crit 14.09% 9.09% 5441
Spell Haste 7.31% 2.20% 934
ManaReg per Second 0 0 0
Attack Power 35369 23234 0
Melee Hit 7.75% 7.75% 2636
Melee Crit 23.57% 16.70% 5441
Melee Haste 2.20% 2.20% 934
Swing Speed 12.42% 2.20% 934
Expertise 7.58% 7.58% 2577
Armor 21466 21466 21466
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.87% 10.87% 1722

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Khorelle"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Khorelle/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/26/69489946-avatar.jpg"
level=90
race=blood_elf
spec=survival
role=attack
position=back
professions=alchemy=600/herbalism=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!201200
glyphs=camouflage/animal_bond/marked_for_death/fetch/aspects/stampede

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/aspect_of_the_hawk
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/arcane_torrent
actions+=/use_item,name=flashing_steel_talisman
actions+=/lifeblood
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!dot.lynx_rush.ticking
actions+=/explosive_shot,if=buff.lock_and_load.react
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking&target.time_to_die>=10
actions+=/explosive_shot,if=cooldown_react
actions+=/kill_shot
actions+=/black_arrow,if=!ticking&target.time_to_die>=8
actions+=/multi_shot,if=buff.thrill_of_the_hunt.react&dot.serpent_sting.remains<2
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/rapid_fire,if=!buff.rapid_fire.up
actions+=/dire_beast,if=enabled
actions+=/stampede,if=buff.rapid_fire.up|buff.bloodlust.react|target.time_to_die<=25
actions+=/readiness,wait_for_rapid_fire=1
actions+=/fervor,if=enabled&focus<=50
actions+=/cobra_shot,if=dot.serpent_sting.remains<6
actions+=/arcane_shot,if=focus>=67
actions+=/cobra_shot

head=osul_peak_helm,id=83650,reforge=haste_exp
neck=choker_of_the_klaxxiva,id=89065,reforge=hit_exp
shoulders=windreaver_spaulder,id=83998,enchant=200agi_100crit
back=arrow_breaking_windcloak,id=86082,enchant=180crit,reforge=haste_crit
chest=undergrowth_stalker_chestpiece,id=89669,enchant=80all,reforge=mastery_crit
shirt=scarlet_filigreed_doublet,id=42368
wrists=stonemaw_armguards,id=85923,enchant=50agi,reforge=haste_exp
hands=yak_herder_gauntlets,id=82547,enchant=170haste,reforge=mastery_hit
waist=impalers_girdle,id=81085,gems=160agi
legs=hopping_mad_leggings,id=81077,gems=80agi_160crit_60crit,enchant=285agi_165crit,reforge=hit_exp
feet=treads_of_ardent_antagonism,id=90906,enchant=140agi
finger1=signet_of_dancing_jade,id=81128
finger2=fengs_seal_of_binding,id=89967,reforge=mastery_hit
trinket1=flashing_steel_talisman,id=81265
trinket2=relic_of_xuen,id=79328
main_hand=tempestuous_longbow,id=81279,enchant=lord_blastingtons_scope_of_doom

# Gear Summary
# gear_strength=80
# gear_agility=10771
# gear_stamina=13435
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2577
# gear_hit_rating=2636
# gear_crit_rating=5441
# gear_haste_rating=934
# gear_mastery_rating=1722
# gear_armor=21466
# main_hand=tempestuous_longbow,weapon=bow_3.00speed_6899min_12813max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Xemynia

Xemynia : 96357 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
96357.3 96357.3 173.41 / 0.18% 4440 / 4.6% 15.5 6109.7 6109.4 Mana 0.00% 37.0 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Xemynia/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#ea!020101
Glyphs
  • arcane_explosion
  • mana_gem
  • evocation
  • rapid_teleportation
  • mirror_image
  • illusion
Professions
  • jewelcrafting: 600
  • enchanting: 610

Charts

http://2.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:164402|142771|123620|120560|74528&chds=0,328804&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++164402++mirror_image,69CCF0,0,0,15|t++142771++arcane_barrage,69CCF0,1,0,15|t++123620++arcane_missiles,69CCF0,2,0,15|t++120560++nether_tempest,69CCF0,3,0,15|t++74528++arcane_blast,69CCF0,4,0,15&chtt=Xemynia Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:43,35,14,7,2,1&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,336600&chl=arcane_blast|arcane_missiles|nether_tempest|arcane_barrage|mirror_image: arcane_blast|stormlash&chtt=Xemynia Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:Ybbggijlmoqtwz256776753411zzxvsqomkigffeeedcbbaaaZaaaZZYYXWWVVVVWWWWWVVVVVVVVVVWWWWWWVVVWWXXYYZZaabcddeeffgghgghhhhggffecbaZZZYYYXXXWWWVVVVVVWWWWWWWWWWWWWWWWWWWWWWXXXXXXXXXWWWWWWWWWWWVVVVVVWWXXYZaabccddeffggggggffeeddcbbaaZZYYYXXXXXXXXXXXXXXXXXWWWWWWWVVVVVVUVVVVVVVVVVVVVWWWWXXXXXYYYYZZZZZaaaabbbbbbbbbaaaaaZZZZZYYYXXXXWWWWWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXWWWWWWWWXXXXXXXXXXXXYYYYYYYYYZZZaaabbcccdddeeefeeeedccbbaaZZYYYXXXXWWWWWXXXXXXXXXXXXXXWXWWWWWWWWWWWWWWWWWWWWWXXXXXXXYYYYZZZZaaabbbbcccccccccbbbaaaZZZYYXXXWWWWVVVVVWWWWWWWWWWXXXYYYYYXXXYYXXXXXYYYYYYYYYYZ&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4393,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=96357|max=219325&chxp=1,1,44,100&chtt=Xemynia DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,1,1,3,6,1,6,9,15,16,26,29,23,40,44,55,45,45,51,51,63,50,49,50,41,35,44,36,37,30,26,19,8,11,11,4,6,3,5,0,0,0,0,0,1,0,0,0,1&chds=0,63&chbh=5&chxt=x&chxl=0:|min=87839|avg=96357|max=107517&chxp=0,1,43,100&chtt=Xemynia DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.6,26.8,10.7,4.8,2.0,0.9&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chl=arcane_blast 246.2s|arcane_missiles 120.8s|nether_tempest 48.5s|arcane_barrage 21.8s|rune_of_power 9.0s|mirror_image 4.2s&chtt=Xemynia Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Xemynia 96357
alter_time_activate 0 0.0% 2.6 197.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.62 2.62 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after {$110909d=6 seconds}. Effect negated if the caster dies within the {$110909d=6 seconds} before the effect occurs or moves too far away.
arcane_barrage 6883 7.2% 16.0 25.77sec 193656 142771 166660 347371 193674 15.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.05 16.05 0.00 0.00 1.3564 0.0000 3107988.92 3107988.92 0.00 142771.32 142771.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.62 84.85% 166659.61 64380 260772 166918.23 137676 194990 2269628 2269628 0.00
crit 2.41 15.04% 347371.23 136703 537189 321559.31 0 535041 838360 838360 0.00
miss 0.02 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1500.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=1431 to 1749 + 119.2%} Arcane damage. Consumes all Arcane Charges. Arcane Barrage's damage is increased by {$36032s1=24}% per Arcane Charge, and it hits {$36032s3=1} additional nearby $Ltarget:targets; per Arcane Charge for {$44425s2=50}% damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.192000
  • base_dd_min:1431.28
  • base_dd_max:1749.34
arcane_blast 40732 42.3% 139.0 3.24sec 131983 74528 113374 237298 131987 15.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.04 139.04 0.00 0.00 1.7709 0.0000 18350709.63 18350709.63 0.00 74527.61 74527.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.91 84.80% 113374.10 41555 223457 113475.52 105453 122878 13367026 13367026 0.00
crit 21.00 15.10% 237298.13 86269 460322 237522.30 187489 295446 4983684 4983684 0.00
miss 0.13 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4499.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=650 to 755 + 100.8%} Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by {$36032s1=24}% per Arcane Charge, and its mana cost is increased by {$36032s2=75}% per Arcane Charge.{$?s86209=false}[ Also applies the Slow spell to any target it damages if no target is currently affected by your Slow.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.008000
  • base_dd_min:649.84
  • base_dd_max:755.21
arcane_missiles 33160 34.4% 61.8 7.14sec 241441 123620 0 0 0 0.0% 0.0% 0.0% 0.0% 308.6 41622 87290 48572 15.3% 0.1% 23.4%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.84 61.84 308.61 307.42 1.9531 0.3416 14931891.73 14931891.73 0.00 123619.63 123619.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 260.1 84.62% 41622.07 15943 68786 41634.93 35825 45342 10827399 10827399 0.00
crit 47.0 15.30% 87289.92 32842 141700 87355.76 69087 102063 4104493 4104493 0.00
miss 0.3 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up|buff.arcane_missiles.stack=2
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing {$7268s1=379 + 28.5%} Arcane damage per wave. Generates an Arcane Charge. Arcane Missiles' damage is increased by {$36032s1=24}% per Arcane Charge. Arcane Missiles has a chance to be activated after each of your damaging spell casts. Limit {$79683s1=2} charges.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing {$7268s1=379 + 28.5%} Arcane damage per wave. Generates an Arcane Charge. Arcane Missiles' damage is increased by {$36032s1=24}% per Arcane Charge. Arcane Missiles has a chance to be activated after each of your damaging spell casts. Limit {$79683s1=2} charges.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.285000
  • base_dd_min:378.84
  • base_dd_max:378.84
arcane_power 0 0.0% 5.2 94.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal {$s1=20}% more spell damage and damaging spells cost {$s2=10}% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
mirror_image 0 (1542) 0.0% (1.6%) 3.0 181.24sec 229823 164402 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.3981 0.0000 0.00 0.00 0.00 164402.06 164402.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=30 seconds}.
nether_tempest 12969 13.5% 35.4 12.72sec 165113 120560 0 0 0 0.0% 0.1% 0.0% 0.0% 492.1 10197 21294 11878 15.2% 0.0% 93.6%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.40 35.40 492.07 492.07 1.3696 0.8584 5844725.28 5844725.28 0.00 12412.00 120559.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.37 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 417.5 84.85% 10196.83 7390 16087 10200.36 9729 10700 4257147 4257147 0.00
crit 74.6 15.15% 21293.91 15505 33139 21303.97 19610 23534 1587578 1587578 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4499.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<tick_time)&target.time_to_die>6
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals {$114923s1=232} Arcane damage every $114923t sec. Deals {$114954s1=117 + 8.7%} Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds}. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 5.4 91.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 5.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
rune_of_power 0 0.0% 6.5 64.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.47 6.47 0.00 0.00 1.3988 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground, which lasts for {$116011d=60 seconds}. While standing in your own Rune of Power, your mana regeneration is increased by {$116014s1=100}% and your spell damage is increased by {$116014s2=15}%. Only {$116011s1=2} Runes of Power can be placed at one time.{$?s56380=true}[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.
stormlash 1071 1.1% 14.8 22.92sec 32032 0 26514 57663 32027 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.85 14.85 0.00 0.00 0.0000 0.0000 475570.61 475570.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.19 82.11% 26514.00 11546 35639 26597.11 20757 33714 323227 323227 0.00
crit 2.64 17.79% 57663.24 24845 73417 54112.33 0 73417 152344 152344 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:11424.16
  • base_dd_max:11424.16
pet - mirror_image 7980 / 1542
arcane_blast 7980 1.6% 121.3 3.27sec 5691 2682 4866 10038 5691 16.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.27 121.27 0.00 0.00 2.1222 0.0000 690159.83 690159.83 0.00 2681.63 2681.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.69 83.85% 4865.89 2148 6484 4866.16 4529 5183 494785 494785 0.00
crit 19.46 16.05% 10038.45 4296 12968 10040.68 7042 11791 195375 195375 0.00
miss 0.12 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88084
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=650 to 755 + 100.8%} Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by {$36032s1=24}% per Arcane Charge, and its mana cost is increased by {$36032s2=75}% per Arcane Charge.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:866.45
  • base_dd_max:1006.95

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.6 0.0 197.9sec 197.9sec 3.48% 3.48%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • alter_time_1:3.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:{$@spelldesc108978=Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after {$110909d=6 seconds}. Effect negated if the caster dies within the {$110909d=6 seconds} before the effect occurs or moves too far away.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_charge 17.0 186.4 25.6sec 2.2sec 88.84% 97.97%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • arcane_charge_1:7.76%
  • arcane_charge_2:7.14%
  • arcane_charge_3:6.99%
  • arcane_charge_4:6.94%
  • arcane_charge_5:6.90%
  • arcane_charge_6:53.10%

Trigger Attempt Success

  • trigger_pct:101.30%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by {$36032s1=24}% per charge, and its mana cost increased by {$36032s2=75}% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by {$36032s1=24}% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a {$1449s2=30}% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by {$36032s1=24}% per charge, and it hits {$36032s3=1} additional nearby $Ltarget:targets; per charge for {$44425s2=50}% damage. Stacks up to {$36032u=6} times and lasts {$36032d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_missiles 26.4 33.9 17.1sec 7.4sec 62.66% 100.00%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_arcane_missiles
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • arcane_missiles_1:59.13%
  • arcane_missiles_2:3.53%

Trigger Attempt Success

  • trigger_pct:31.79%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to {$79683s1=2} charges and lasts {$79683d=20 seconds}.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 5.7 2.2 85.8sec 59.2sec 20.32% 100.00%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • arcane_power_1:20.32%

Trigger Attempt Success

  • trigger_pct:149.79%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal {$s1=20}% more spell damage and damaging spells cost {$s2=10}% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
  • max_stacks:
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
bloodlust 1.0 0.9 0.0sec 13.0sec 10.23% 13.11%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.23%

Trigger Attempt Success

  • trigger_pct:189.99%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
jade_serpent_potion 1.2 0.7 79.7sec 73.6sec 11.34% 11.34%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.34%

    Trigger Attempt Success

    • trigger_pct:197.30%
jade_spirit 11.9 7.8 37.5sec 22.1sec 39.76% 40.41%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:39.76%

    Trigger Attempt Success

    • trigger_pct:2.06%
light_of_the_cosmos 9.3 1.1 49.9sec 44.1sec 41.47% 41.47%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3236.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.47%

    Trigger Attempt Success

    • trigger_pct:18.77%
presence_of_mind 5.4 0.0 91.3sec 91.3sec 1.00% 3.72%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • presence_of_mind_1:1.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:100.00%
rune_of_power 6.5 2.6 64.7sec 49.5sec 96.43% 96.40%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rune_of_power_1:96.43%

Trigger Attempt Success

  • trigger_pct:140.55%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Mana regeneration increased by $w1%. Spell damage increased by $w2%.$?$w3=0[][ Health restored by $w3% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground, which lasts for {$116011d=60 seconds}. While standing in your own Rune of Power, your mana regeneration is increased by {$116014s1=100}% and your spell damage is increased by {$116014s2=15}%. Only {$116011s1=2} Runes of Power can be placed at one time.{$?s56380=true}[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.}
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
stormlash 3.8 1.0 109.9sec 80.2sec 9.21% 9.21%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.21%

Trigger Attempt Success

  • trigger_pct:121.92%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
vision_of_the_predator 4.6 0.8 108.3sec 87.7sec 31.03% 31.03%

Buff details

  • buff initial source:Xemynia
  • cooldown name:buff_vision_of_the_predator
  • max_stacks:1
  • duration:30.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3386.00

    Stack Uptimes

    • vision_of_the_predator_1:31.03%

    Trigger Attempt Success

    • trigger_pct:20.22%
mirror_image-arcane_charge 3.0 37.4 181.3sec 9.7sec 92.16% 92.60%

Buff details

  • buff initial source:Xemynia_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • arcane_charge_1:7.87%
  • arcane_charge_2:7.81%
  • arcane_charge_3:7.16%
  • arcane_charge_4:7.10%
  • arcane_charge_5:7.06%
  • arcane_charge_6:55.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by {$36032s1=24}% per charge, and its mana cost increased by {$36032s2=75}% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by {$36032s1=24}% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a {$1449s2=30}% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by {$36032s1=24}% per charge, and it hits {$36032s3=1} additional nearby $Ltarget:targets; per charge for {$44425s2=50}% damage. Stacks up to {$36032u=6} times and lasts {$36032d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 37.4 181.3sec 9.7sec 92.16% 92.60%

Buff details

  • buff initial source:Xemynia_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • arcane_charge_1:7.87%
  • arcane_charge_2:7.81%
  • arcane_charge_3:7.16%
  • arcane_charge_4:7.10%
  • arcane_charge_5:7.06%
  • arcane_charge_6:55.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by {$36032s1=24}% per charge, and its mana cost increased by {$36032s2=75}% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by {$36032s1=24}% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a {$1449s2=30}% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by {$36032s1=24}% per charge, and it hits {$36032s3=1} additional nearby $Ltarget:targets; per charge for {$44425s2=50}% damage. Stacks up to {$36032u=6} times and lasts {$36032d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 37.4 181.3sec 9.7sec 92.16% 92.60%

Buff details

  • buff initial source:Xemynia_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • arcane_charge_1:7.87%
  • arcane_charge_2:7.81%
  • arcane_charge_3:7.16%
  • arcane_charge_4:7.11%
  • arcane_charge_5:7.06%
  • arcane_charge_6:55.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by {$36032s1=24}% per charge, and its mana cost increased by {$36032s2=75}% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by {$36032s1=24}% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a {$1449s2=30}% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by {$36032s1=24}% per charge, and it hits {$36032s3=1} additional nearby $Ltarget:targets; per charge for {$44425s2=50}% damage. Stacks up to {$36032u=6} times and lasts {$36032d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Xemynia
alter_time_activate Mana 2.6 8646.0 3300.0 3300.5 0.0
arcane_barrage Mana 16.1 24601.7 1532.8 1532.9 126.3
arcane_blast Mana 139.0 2542164.2 18285.0 18283.9 7.2
mirror_image Mana 3.0 18018.0 6000.0 6000.0 38.3
nether_tempest Mana 35.4 162638.9 4594.7 4594.5 35.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.90 1374344.92 (49.87%) 761.88 202692.13 12.85%
mana_gem Mana 1.78 89990.21 (3.27%) 50499.56 5640.34 5.90%
rune_of_power Mana 1738.85 1291601.16 (46.87%) 742.79 230236.36 15.13%
Resource RPS-Gain RPS-Loss
Mana 6109.38 6109.67
Combat End Resource Mean Min Max
Health 396835.00 396835.00 396835.00
Mana 262927.51 152849.64 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Arcane Charge 0 7.4%
Arcane Charge 1 7.4%
Arcane Charge 2 7.3%
Arcane Charge 3 7.3%
Arcane Charge 4 7.3%
Arcane Charge 5 7.3%
Arcane Charge 6 56.1%
dps rotation 100.0%
water_elemental-Arcane Charge 0 7.4%
water_elemental-Arcane Charge 1 7.4%
water_elemental-Arcane Charge 2 7.3%
water_elemental-Arcane Charge 3 7.3%
water_elemental-Arcane Charge 4 7.3%
water_elemental-Arcane Charge 5 7.3%
water_elemental-Arcane Charge 6 56.1%
water_elemental-dps rotation 100.0%
Uptimes %
Mana Cap 14.1%
water_elemental-Mana Cap 14.1%
mirror_image-Mana Cap 14.1%

Procs

Count Interval
mana_gem 1.8 228.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Xemynia Damage Per Second
Count 999
Mean 96357.26
Minimum 87838.61
Maximum 107516.80
Spread ( max - min ) 19678.19
Range [ ( max - min ) / 2 * 100% ] 10.21%
Standard Deviation 2796.4044
5th Percentile 91946.21
95th Percentile 100825.25
( 95th Percentile - 5th Percentile ) 8879.04
Mean Distribution
Standard Deviation 88.4743
95.00% Confidence Intervall ( 96183.85 - 96530.67 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3235
0.1 Scale Factor Error with Delta=300 66754
0.05 Scale Factor Error with Delta=300 267019
0.01 Scale Factor Error with Delta=300 6675497
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 96357.26
Distribution Chart

Damage

Sample Data
Count 999
Mean 42710886.17
Distribution Chart

DTPS

Sample Data Xemynia Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Xemynia Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Xemynia Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 278.54
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 mage_armor
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 cancel_buff,name=alter_time,moving=1
9 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
A 0.00 time_warp,if=target.health.pct<25|time>5
B 0.23 arcane_power,if=target.time_to_die<18
C 2.62 alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6,moving=0
D 0.00 arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
E 39.55 arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
F 6.49 rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
G 1.00 jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
H 1.78 mana_gem,if=mana.pct<84&buff.alter_time.down
I 3.00 mirror_image
J 5.02 arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
K 5.42 presence_of_mind,if=buff.alter_time.down
L 35.40 nether_tempest,if=(!ticking|remains<tick_time)&target.time_to_die>6
M 125.99 arcane_blast,if=mana.pct>92
N 22.30 arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
O 4.38 arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
P 11.67 arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
Q 13.68 arcane_blast
R 0.00 arcane_barrage,moving=1
S 0.00 fire_blast,moving=1
T 0.00 ice_lance,moving=1

Sample Sequence

IKLMMJMMMMCEELMEEMNMPMLMMMMMNMPLMMEMEMMELMNMPMMLFMMMMNLMNMPMMLMKMMJGMNMLPMMMMMELMNMPMMLFMMMEMLEMEMMNLMQENMPLMMMMMMELIMKNMPMEFJLMMMMQCEELMEHMEMNLMOEMMELMMEMNMLMONMMMLFMMEMELEKMMNMOLEMJMEMMLNMPMMELMMMNMOEFLEMMMEMLEMNMMPLMMEMEMEILKMMNMPMLMMMEFJMLMCEEMPELMNMQNPLMMMMMMLMEMEMNLMQNMQHMMF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 122 116 80
Agility 137 130 80
Stamina 17888 16262 16195
Intellect 16200 14064 13178
Spirit 285 285 80
Health 396835 374071 0
Mana 300000 300000 0
Spell Power 24636 20260 6206
Spell Hit 14.92% 14.92% 4624
Spell Crit 15.28% 9.44% 1788
Spell Haste 13.15% 7.76% 3298
ManaReg per Second 3394 3233 0
Attack Power 112 96 0
Melee Hit 13.60% 13.60% 4624
Melee Crit 11.61% 6.60% 1788
Melee Haste 7.76% 7.76% 3298
Swing Speed 18.54% 7.76% 3298
Expertise 1.32% 1.32% 448
Armor 13678 13678 13678
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 60.28% 40.28% 7282

Gear

Source Slot Average Item Level: 484.06
Local Head hood_of_the_burning_scroll,id=86717,gems=burning_primal_160hit_160mastery_180int,reforge=crit_hit
Local Neck worldwaker_cachabon,id=86152,reforge=crit_hit
Local Shoulders mantle_of_the_burning_scroll,id=86714,gems=160hit_160mastery_60int,enchant=200int_100crit,reforge=hit_haste
Shirt empty
Local Chest robes_of_the_unknown_fear,id=86892,gems=320int_320mastery_120int,enchant=80all,reforge=mastery_exp
Local Waist invokers_belt_of_final_winter,id=86896,gems=160hit_160mastery_320mastery_60mastery,reforge=hit_haste
Local Legs leggings_of_the_burning_scroll,id=86716,gems=320int_60int,enchant=170int_100crit,reforge=haste_hit
Local Feet sandals_of_the_blackest_night,id=86888,gems=320mastery_60mastery,enchant=140mastery,reforge=haste_hit
Local Wrists twisting_wind_bracers,id=86828,enchant=170mastery,reforge=hit_mastery
Local Hands gloves_of_the_burning_scroll,id=86718,enchant=170mastery,reforge=haste_mastery
Local Finger1 simple_harmonius_ring,id=89072,enchant=160int,reforge=haste_exp
Local Finger2 fragment_of_fear_made_flesh,id=86814,enchant=160int,reforge=crit_mastery
Local Trinket1 light_of_the_cosmos,id=86133,reforge=haste_mastery
Local Trinket2 vision_of_the_predator,id=81192
Local Back mindshard_drape,id=89819,enchant=180int,reforge=crit_hit
Local Main Hand regails_crackling_dagger,id=86909,gems=160hit_160mastery_60crit,enchant=jade_spirit,reforge=crit_haste
Local Off Hand tornadosummoning_censer,id=86171,enchant=165int,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Xemynia"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Xemynia/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/69/16667205-avatar.jpg"
level=90
race=blood_elf
spec=arcane
role=spell
position=back
professions=jewelcrafting=600/enchanting=610
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ea!020101
glyphs=arcane_explosion/mana_gem/evocation/rapid_teleportation/mirror_image/illusion

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/mage_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/cancel_buff,name=alter_time,moving=1
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/arcane_power,if=target.time_to_die<18
actions+=/alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6,moving=0
actions+=/arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
actions+=/rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/mirror_image
actions+=/arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=(!ticking|remains<tick_time)&target.time_to_die>6
actions+=/arcane_blast,if=mana.pct>92
actions+=/arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
actions+=/arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
actions+=/arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
actions+=/arcane_blast
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=86717,gems=burning_primal_160hit_160mastery_180int,reforge=crit_hit
neck=worldwaker_cachabon,id=86152,reforge=crit_hit
shoulders=mantle_of_the_burning_scroll,id=86714,gems=160hit_160mastery_60int,enchant=200int_100crit,reforge=hit_haste
back=mindshard_drape,id=89819,enchant=180int,reforge=crit_hit
chest=robes_of_the_unknown_fear,id=86892,gems=320int_320mastery_120int,enchant=80all,reforge=mastery_exp
wrists=twisting_wind_bracers,id=86828,enchant=170mastery,reforge=hit_mastery
hands=gloves_of_the_burning_scroll,id=86718,enchant=170mastery,reforge=haste_mastery
waist=invokers_belt_of_final_winter,id=86896,gems=160hit_160mastery_320mastery_60mastery,reforge=hit_haste
legs=leggings_of_the_burning_scroll,id=86716,gems=320int_60int,enchant=170int_100crit,reforge=haste_hit
feet=sandals_of_the_blackest_night,id=86888,gems=320mastery_60mastery,enchant=140mastery,reforge=haste_hit
finger1=simple_harmonius_ring,id=89072,enchant=160int,reforge=haste_exp
finger2=fragment_of_fear_made_flesh,id=86814,enchant=160int,reforge=crit_mastery
trinket1=light_of_the_cosmos,id=86133,reforge=haste_mastery
trinket2=vision_of_the_predator,id=81192
main_hand=regails_crackling_dagger,id=86909,gems=160hit_160mastery_60crit,enchant=jade_spirit,reforge=crit_haste
off_hand=tornadosummoning_censer,id=86171,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=16195
# gear_intellect=13178
# gear_spirit=80
# gear_spell_power=6206
# gear_expertise_rating=448
# gear_hit_rating=4624
# gear_crit_rating=1788
# gear_haste_rating=3298
# gear_mastery_rating=7282
# gear_armor=13678
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# main_hand=regails_crackling_dagger,weapon=dagger_1.80speed_1849min_3435max,enchant=jade_spirit

Nerghal

Nerghal : 91100 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
91100.1 91100.1 214.78 / 0.24% 5634 / 6.2% 16.7 5357.2 5337.0 Mana 0.00% 37.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Nerghal/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#eZ!022111
Glyphs
  • combustion
  • fire_blast
  • evocation
  • loose_mana
  • illusion
  • conjure_familiar
Professions
  • tailoring: 600
  • enchanting: 600

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:196092|167635|105545|42560|37981&chds=0,392184&chco=C41F3B,69CCF0,C41F3B,C41F3B,C41F3B&chm=t++196092++pyroblast,C41F3B,0,0,15|t++167635++mirror_image,69CCF0,1,0,15|t++105545++living_bomb,C41F3B,2,0,15|t++42560++fireball,C41F3B,3,0,15|t++37981++inferno_blast,C41F3B,4,0,15&chtt=Nerghal Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:32,30,15,8,5,4,4,2,1,0&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,336600,0070DE,C41F3B&chl=fireball|pyroblast|ignite|combustion|living_bomb|living_bomb_explosion|inferno_blast|stormlash|mirror_image: frostbolt|mirror_image: fire_blast&chtt=Nerghal Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:Zdfilmnopqrux025778766431zyxvusqomkjgfeedcbbaaZZYYYZYZZZYYYXXXWXXYYYYYYZYYYYYZZaaabbbbbbbbbbbbbbaaaZZZZZYYYYYYYYYYYYYYYYYYYYXXXXWXWWWWWVVVUVUUUVVWWWWXXXXXYYZZaabbccccccccccccccbbaaZZYYXXXXXXXXXXXXXXXYYZZZZZZZZZZZZZZZZZZZZaaaaabbbbbcccccccccccbbbbaaZZZYYYXXXXWWWWVVWWXXXXXYYYYYYYYYYYYYYXXWWWWWWXXXYYYZZaabbccdeeeeeeedddddcccbbaaZZYYXXXXXXXXWWWWWWWWWWWWWWWWWWXXXYYYZZaabbbcccddeeeeefffffffeeeedddccbbbaaaZZZYYYYXXXXXXYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZaaabbbbcccccccbbbbbbbbaaaaZZZZZZZZYZZZZZZZZZZYZZZZZZZYYYYYYYYYYYYYYZZZZZZaaabbbcccdddddddcccccbaaaZZZYYYXXWWW&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4528,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=91100|max=201202&chxp=1,1,45,100&chtt=Nerghal DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,0,1,1,0,1,5,5,6,10,11,11,19,20,41,42,44,40,56,62,48,47,62,50,48,41,41,48,29,39,31,18,23,27,17,4,12,8,6,7,2,8,0,3,1,0,1,0,1&chds=0,62&chbh=5&chxt=x&chxl=0:|min=79885|avg=91100|max=103342&chxp=0,1,48,100&chtt=Nerghal DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:66.4,13.6,8.9,8.1,2.0,0.9&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,C41F3B,69CCF0,69CCF0&chl=fireball 299.6s|pyroblast 61.5s|inferno_blast 40.0s|living_bomb 36.5s|rune_of_power 8.8s|mirror_image 4.2s&chtt=Nerghal Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Nerghal 91100
alter_time_activate 0 0.0% 2.8 187.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.80 2.80 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.pyroblast.react&buff.rune_of_power.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after {$110909d=6 seconds}. Effect negated if the caster dies within the {$110909d=6 seconds} before the effect occurs or moves too far away.
combustion 7520 8.2% 6.5 73.23sec 518539 0 72851 151857 93592 26.3% 0.0% 0.0% 0.0% 152.1 14190 29787 18242 26.0% 0.0% 28.5%

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.53 6.53 152.09 152.09 0.0000 0.8441 3385294.20 3385294.20 0.00 26368.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.81 73.70% 72850.70 53060 99827 72900.92 61019 91384 350575 350575 0.00
crit 1.72 26.28% 151856.63 109304 205643 131308.24 0 205643 260523 260523 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.6 74.03% 14190.13 3388 43945 14223.64 9142 22313 1597592 1597592 0.00
crit 39.5 25.97% 29787.08 6979 85805 29763.33 16724 47673 1176604 1176604 0.00
DPS Timeline Chart

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:72.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die<12
Spelldata
  • id:11129
  • name:Combustion
  • school:fire
  • tooltip:
  • description:Instantly deals {$s2=7158 to 7335} Fire damage and stuns the target for {$118271d=3 seconds}. If the target is currently affected by your Ignite, it also burns the target for additional damage equal to the damage per tick of the Ignite every {$83853t1=1} sec for {$83853d=10 seconds}. When cast, resets the cooldown of your Inferno Blast ability.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:952.31
  • base_dd_max:1129.24
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:11993.50
  • num_ticks:20
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
fireball 28291 31.1% 150.3 2.99sec 84837 42560 61886 128832 84968 34.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.29 150.07 0.00 0.00 1.9934 0.0000 12750146.16 12750146.16 0.00 42559.65 42559.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.28 65.49% 61885.95 41784 86474 61910.81 59766 64993 6082401 6082401 0.00
crit 51.75 34.49% 128832.37 86076 178137 128872.54 123343 135289 6667745 6667745 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Hurls a fiery ball that causes {$s1=10683 to 11058} Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
ignite 13570 14.9% 224.5 2.00sec 27242 0 0 0 0 0.0% 0.0% 0.0% 0.0% 222.7 27472 0 27472 0.0% 0.0% 98.7%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.54 224.54 222.68 222.68 0.0000 2.0000 6116943.83 6116943.83 0.00 13734.98 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 224.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 222.7 100.00% 27471.95 4990 105963 27495.03 23733 32818 6116944 6116944 0.00
DPS Timeline Chart

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every {$t1=2} sec.
  • description:{$@spelldesc12846=Your target burns for an additional {$m1=0}% over {$12654d=4 seconds} of the total damage caused by your Fireball, Frostfire Bolt, Inferno Blast, Scorch, and Pyroblast. If this effect is reapplied, any remaining damage will be added to the new Ignite.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:17289.59
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
inferno_blast 3372 3.7% 29.4 15.24sec 51661 37981 0 51670 51662 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inferno_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.42 29.42 0.00 0.00 1.3602 0.0000 1519734.55 1519734.55 0.00 37981.02 37981.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 29.41 99.98% 51670.39 34429 71254 51689.90 49049 54444 1519735 1519735 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inferno_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.react&buff.pyroblast.down
Spelldata
  • id:108853
  • name:Inferno Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=4295 to 4401} Fire damage, and is guaranteed to critical strike. Upon impact, it spreads any {$?s89926=true}&s44457[Living Bomb, ][]Pyroblast, Ignite, and Combustion effects to up to 2 nearby enemy targets within $118280A1 yards. {$?s89926=true}&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards. ][]{$?s89926=true}&s112948[Also instantly triggers your Frost Bomb effect. ][]Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:571.39
  • base_dd_max:677.55
living_bomb 4821 (8554) 5.3% (9.4%) 34.0 13.35sec 113301 105545 0 0 0 0.0% 0.0% 0.0% 0.0% 171.2 9919 20629 12696 25.9% 0.0% 97.5%

Stats details: living_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.03 34.03 171.16 171.16 1.0735 2.5693 2173070.68 2173070.68 0.00 8095.21 105544.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.02 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.8 74.07% 9919.21 7323 13719 9922.35 9561 10309 1257598 1257598 0.00
crit 44.4 25.93% 20629.27 15085 28260 20639.29 19043 21896 915472 915472 0.00
DPS Timeline Chart

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:4499.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<tick_time)&target.time_to_die>tick_time*3
Spelldata
  • id:44457
  • name:Living Bomb
  • school:fire
  • tooltip:Causes {$s1=347} Fire damage every {$t1=3} sec. After {$d=12 seconds}, the target explodes causing {$44461s1=7880} Fire damage to up to 3 enemies within $44461A1 yards.
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over {$44457d=12 seconds}. When this effect ends, or the target dies, it explodes to deal an additional {$44461s1=7880} Fire damage to up to 3 enemies within $44461A1 yards. Limit 3 targets. This spell has a 1.0 sec global cooldown.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.260000
  • base_td:346.58
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 3733 4.1% 34.0 13.24sec 49456 0 39642 82717 50748 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.02 33.15 0.00 0.00 0.0000 0.0000 1682691.76 1682691.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.59 74.17% 39642.40 29433 55138 39648.41 37385 41871 974820 974820 0.00
crit 8.56 25.81% 82717.18 60631 113585 82766.90 72326 99170 707872 707872 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:44461
  • name:Living Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc44457=The target becomes a Living Bomb, taking $44457o1 Fire damage over {$44457d=12 seconds}. When this effect ends, or the target dies, it explodes to deal an additional {$44461s1=7880} Fire damage to up to 3 enemies within $44461A1 yards. Limit 3 targets. This spell has a 1.0 sec global cooldown.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.045000
  • base_dd_min:1394.64
  • base_dd_max:1394.64
mirror_image 0 (1568) 0.0% (1.7%) 3.0 181.62sec 234241 167635 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.3974 0.0000 0.00 0.00 0.00 167634.73 167634.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=30 seconds}.
presence_of_mind 0 0.0% 5.4 91.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.41 5.41 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pyroblast 26772 29.4% 45.3 9.79sec 266174 196092 121997 254596 167118 34.0% 0.0% 0.0% 0.0% 164.3 19919 41520 27417 34.7% 0.0% 93.3%

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.33 45.24 164.29 164.29 1.3574 2.5604 12064941.50 12064941.50 0.00 25021.45 196091.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.83 65.93% 121997.04 71179 171220 122056.86 113367 131968 3638611 3638611 0.00
crit 15.40 34.05% 254595.69 146629 352714 254764.27 220290 294441 3921879 3921879 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.3 65.29% 19918.88 11648 28018 19925.46 18924 21053 2136455 2136455 0.00
crit 57.0 34.71% 41520.00 22312 57718 41532.10 38616 44823 2367996 2367996 0.00
DPS Timeline Chart

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:$w2 Fire damage every {$t2=3} seconds.
  • description:Hurls an immense fiery boulder that causes {$s1=15670 to 16215} Fire damage and an additional $o2 Fire damage over {$d=18 seconds}. Getting two single-target direct-damage Fire critical strikes in a row will make your next Pyroblast instant cast, cost no mana, and deal {$s3=25}% additional damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.200000
  • base_dd_min:2017.24
  • base_dd_max:2562.19
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.360000
  • base_td:374.68
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
rune_of_power 0 0.0% 6.3 63.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.33 6.33 0.00 0.00 1.3973 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground, which lasts for {$116011d=60 seconds}. While standing in your own Rune of Power, your mana regeneration is increased by {$116014s1=100}% and your spell damage is increased by {$116014s2=15}%. Only {$116011s1=2} Runes of Power can be placed at one time.{$?s56380=true}[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.
stormlash 1452 1.6% 26.0 12.75sec 24755 0 18923 39803 24759 28.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.05 26.05 0.00 0.00 0.0000 0.0000 644759.93 644759.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.75 71.99% 18923.29 8029 35806 18931.14 14955 22540 354809 354809 0.00
crit 7.29 27.97% 39803.37 17838 73760 39845.41 26753 63073 289951 289951 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:14888.11
  • base_dd_max:14888.11
pet - mirror_image 8131 / 1568
fire_blast 1780 0.4% 43.3 30.54sec 3547 0 2789 5625 3547 26.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.31 43.31 0.00 0.00 0.0000 0.0000 153608.34 153608.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.73 73.27% 2789.41 2442 3332 2790.29 2674 2944 88507 88507 0.00
crit 11.57 26.72% 5624.87 4883 6665 5626.91 5124 6437 65101 65101 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59637
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.005000
  • base_dd_min:984.34
  • base_dd_max:1105.55
frostbolt 6351 1.3% 150.7 7.77sec 3636 2227 2870 5796 3650 26.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.68 150.13 0.00 0.00 1.6331 0.0000 547942.99 547942.99 0.00 2226.69 2226.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.08 73.32% 2870.07 2470 3372 2871.34 2730 3019 315946 315946 0.00
crit 40.02 26.66% 5796.25 4941 6743 5799.42 5462 6161 231997 231997 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.017000
  • base_dd_min:1004.56
  • base_dd_max:1110.30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.8 0.0 188.0sec 188.0sec 3.72% 3.72%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • alter_time_1:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:{$@spelldesc108978=Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after {$110909d=6 seconds}. Effect negated if the caster dies within the {$110909d=6 seconds} before the effect occurs or moves too far away.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 1.0 40.3sec 10.6sec 10.37% 12.24%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:10.37%

Trigger Attempt Success

  • trigger_pct:200.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
heating_up 59.3 0.2 7.5sec 7.5sec 22.71% 40.20%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • heating_up_1:22.67%
  • heating_up_2:0.04%

Trigger Attempt Success

  • trigger_pct:101.25%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal {$11366s3=25}% additional damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal {$11366s3=25}% additional damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.1 1.0 368.8sec 351.4sec 11.56% 11.56%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.56%

    Trigger Attempt Success

    • trigger_pct:210.61%
jade_spirit 11.7 7.9 38.0sec 22.0sec 39.75% 40.51%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:39.75%

    Trigger Attempt Success

    • trigger_pct:2.04%
light_of_the_cosmos 9.5 0.8 49.0sec 44.9sec 41.88% 41.88%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3236.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.88%

    Trigger Attempt Success

    • trigger_pct:16.71%
lightweave_embroidery_3 8.6 1.0 54.8sec 48.7sec 27.98% 27.98%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:57.00
  • default_chance:25.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:27.98%

    Trigger Attempt Success

    • trigger_pct:28.70%
presence_of_mind 5.4 0.0 91.5sec 91.5sec 0.32% 3.37%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • presence_of_mind_1:0.32%

Trigger Attempt Success

  • trigger_pct:100.02%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:100.00%
pyroblast 41.6 0.7 10.7sec 10.5sec 14.07% 91.32%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_pyroblast
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • pyroblast_1:14.07%

Trigger Attempt Success

  • trigger_pct:107.10%

Spelldata details

  • id:48108
  • name:Pyroblast!
  • tooltip:Your next Pyroblast spell is instant cast, costs no mana, and deals {$11366s3=25}% additional damage.
  • description:Getting two direct-damage critical strikes in a row will make your next Pyroblast spell instant cast, cost no mana, and deal {$11366s3=25}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
relic_of_yulon 9.3 0.9 50.8sec 45.7sec 30.73% 30.73%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.73%

    Trigger Attempt Success

    • trigger_pct:22.42%
rune_of_power 6.3 2.8 64.6sec 48.9sec 96.66% 96.63%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rune_of_power_1:96.66%

Trigger Attempt Success

  • trigger_pct:144.13%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Mana regeneration increased by $w1%. Spell damage increased by $w2%.$?$w3=0[][ Health restored by $w3% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground, which lasts for {$116011d=60 seconds}. While standing in your own Rune of Power, your mana regeneration is increased by {$116014s1=100}% and your spell damage is increased by {$116014s2=15}%. Only {$116011s1=2} Runes of Power can be placed at one time.{$?s56380=true}[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.}
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
stormlash 3.6 1.2 119.9sec 82.3sec 9.22% 9.22%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.22%

Trigger Attempt Success

  • trigger_pct:119.54%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Nerghal
alter_time_activate Mana 2.8 8403.0 3000.0 3000.2 0.0
combustion Mana 6.5 195870.0 30000.0 30002.2 17.3
fireball Mana 150.3 1803432.0 12000.0 11999.7 7.1
inferno_blast Mana 29.4 176508.0 6000.0 6000.1 8.6
living_bomb Mana 34.0 153101.0 4499.0 4498.9 25.2
mirror_image Mana 3.0 17970.0 6000.0 6000.0 39.0
pyroblast Mana 45.3 58770.0 1296.4 1296.6 205.3
time_warp Mana 0.2 2568.0 12000.0 12044.3 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.90 1250329.58 (51.93%) 693.13 328168.74 20.79%
mana_gem Mana 0.07 3327.82 (0.14%) 49668.96 79.10 2.32%
rune_of_power Mana 1742.91 1153879.93 (47.93%) 662.04 372834.61 24.42%
Resource RPS-Gain RPS-Loss
Mana 5337.04 5357.18
Combat End Resource Mean Min Max
Health 400027.00 400027.00 400027.00
Mana 288951.93 244671.74 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps rotation 100.0%
water_elemental-dps rotation 100.0%
mirror_image-dps rotation 100.0%
Uptimes %
Mana Cap 21.1%
water_elemental-Mana Cap 21.1%
mirror_image-Mana Cap 21.1%

Procs

Count Interval
mana_gem 0.1 139.7sec
test_for_crit_hotstreak 231.2 1.9sec
crit_test_hotstreak 98.3 4.5sec
hotstreak 39.5 11.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Nerghal Damage Per Second
Count 999
Mean 91100.06
Minimum 79884.58
Maximum 103342.09
Spread ( max - min ) 23457.52
Range [ ( max - min ) / 2 * 100% ] 12.87%
Standard Deviation 3463.6253
5th Percentile 85793.40
95th Percentile 97061.86
( 95th Percentile - 5th Percentile ) 11268.46
Mean Distribution
Standard Deviation 109.5843
95.00% Confidence Intervall ( 90885.28 - 91314.84 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5552
0.1 Scale Factor Error with Delta=300 102410
0.05 Scale Factor Error with Delta=300 409642
0.01 Scale Factor Error with Delta=300 10241073
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 91100.06
Distribution Chart

Damage

Sample Data
Count 999
Mean 40337582.61
Distribution Chart

DTPS

Sample Data Nerghal Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Nerghal Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Nerghal Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 285.06
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 molten_armor
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 cancel_buff,name=alter_time,moving=1
9 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
A 0.21 time_warp,if=target.health.pct<25|time>5
B 0.19 combustion,if=target.time_to_die<12
C 6.34 combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
D 0.00 combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
E 6.33 rune_of_power,if=buff.rune_of_power.down&target.time_to_die>12
F 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
G 0.07 mana_gem,if=mana.pct<84&buff.alter_time.down
H 2.80 alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.rune_of_power.remains>6,moving=0
I 41.33 pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
J 4.00 pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
K 29.42 inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
L 3.00 mirror_image
M 5.41 presence_of_mind,if=buff.alter_time.down
N 34.03 living_bomb,if=(!ticking|remains<tick_time)&target.time_to_die>tick_time*3
O 150.94 fireball
P 0.00 inferno_blast,moving=1
Q 0.00 ice_lance,moving=1

Sample Sequence

LMNOKAHICOOKIOINOOOOOONOOKIOOOONOOOOOIONOOKIOONOOEOOOKINOCOKIOONOMJOOOKINOOOOONOKIOOOOENOOKIOONOOOOOCOINOOOOKINOOOOKILNMOOKOEHIONOIOIIOONOOKIOONOOCOOOOKINOOOOKINIOOKIEONOKIOOOMJNKIOOOKINIOOOOCONOOOKIOONOOEOOKINOOIOOONOKIOOONOKIOLOKIMNOOCOOKONOEHIOOKIONOOOIOONOOOOFOOKINOOIOKINOOOKIBOKIONOO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 122 116 80
Agility 137 130 80
Stamina 18116 16469 16402
Intellect 16976 14803 13881
Spirit 285 285 80
Health 400027 376969 0
Mana 300000 300000 0
Spell Power 25489 20999 6206
Spell Hit 14.98% 14.98% 5093
Spell Crit 27.11% 16.25% 5700
Spell Haste 13.21% 7.82% 2869
ManaReg per Second 3396 3235 0
Attack Power 112 96 0
Melee Hit 14.98% 14.98% 5093
Melee Crit 18.13% 13.12% 5700
Melee Haste 6.75% 6.75% 2869
Swing Speed 18.60% 7.82% 2869
Expertise 0.00% 0.00% 0
Armor 13783 13783 13783
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 28.32% 20.82% 3531

Gear

Source Slot Average Item Level: 485.56
Local Head hood_of_the_burning_scroll,id=86717,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
Local Neck burning_necklace_of_the_golden_lotus,id=90596
Local Shoulders mantle_of_the_burning_scroll,id=86714,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
Local Shirt sleeveless_tshirt,id=18231
Local Chest imperial_ghostbinders_robes,id=85990,gems=80int_160crit_320crit_120int,enchant=80all,reforge=mastery_hit
Local Waist orbital_belt,id=86798,gems=320crit_80int_160hit_320crit_120haste,reforge=haste_hit
Local Legs leggings_of_the_burning_scroll,id=85376,gems=80int_160crit_60int,enchant=285int_165crit,reforge=haste_hit
Local Feet sandals_of_the_shadow,id=90913,enchant=175hit,reforge=haste_crit
Local Wrists attenuating_bracers,id=86157,enchant=180int,reforge=haste_crit
Local Hands gloves_of_the_burning_scroll,id=86718,enchant=170mastery,reforge=haste_crit
Local Finger1 dominators_band,id=93249,enchant=160int,reforge=haste_hit
Local Finger2 seal_of_the_lucid,id=90859,enchant=160int,reforge=mastery_crit
Local Trinket1 light_of_the_cosmos,id=86133,reforge=haste_crit
Local Trinket2 relic_of_yulon,id=79331
Local Back cloak_of_snow_blossoms,id=89077,enchant=lightweave_embroidery_3,reforge=mastery_crit
Local Main Hand loshan_terror_incarnate,id=86886,gems=500int,enchant=jade_spirit,reforge=haste_hit
Local Off Hand inscribed_jade_fan,id=79334,enchant=165int,reforge=mastery_crit
Unknown empty
Local Tabard renowned_guild_tabard,id=69210

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Nerghal"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Nerghal/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/186/2015930-avatar.jpg"
level=90
race=goblin
spec=fire
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eZ!022111
glyphs=combustion/fire_blast/evocation/loose_mana/illusion/conjure_familiar

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/molten_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/cancel_buff,name=alter_time,moving=1
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/combustion,if=target.time_to_die<12
actions+=/combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
actions+=/rune_of_power,if=buff.rune_of_power.down&target.time_to_die>12
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.rune_of_power.remains>6,moving=0
actions+=/pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
actions+=/pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
actions+=/inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
actions+=/mirror_image
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/living_bomb,if=(!ticking|remains<tick_time)&target.time_to_die>tick_time*3
actions+=/fireball
actions+=/inferno_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=86717,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
neck=burning_necklace_of_the_golden_lotus,id=90596
shoulders=mantle_of_the_burning_scroll,id=86714,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_snow_blossoms,id=89077,enchant=lightweave_embroidery_3,reforge=mastery_crit
chest=imperial_ghostbinders_robes,id=85990,gems=80int_160crit_320crit_120int,enchant=80all,reforge=mastery_hit
shirt=sleeveless_tshirt,id=18231
tabard=renowned_guild_tabard,id=69210
wrists=attenuating_bracers,id=86157,enchant=180int,reforge=haste_crit
hands=gloves_of_the_burning_scroll,id=86718,enchant=170mastery,reforge=haste_crit
waist=orbital_belt,id=86798,gems=320crit_80int_160hit_320crit_120haste,reforge=haste_hit
legs=leggings_of_the_burning_scroll,id=85376,gems=80int_160crit_60int,enchant=285int_165crit,reforge=haste_hit
feet=sandals_of_the_shadow,id=90913,enchant=175hit,reforge=haste_crit
finger1=dominators_band,id=93249,enchant=160int,reforge=haste_hit
finger2=seal_of_the_lucid,id=90859,enchant=160int,reforge=mastery_crit
trinket1=light_of_the_cosmos,id=86133,reforge=haste_crit
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=86886,gems=500int,enchant=jade_spirit,reforge=haste_hit
off_hand=inscribed_jade_fan,id=79334,enchant=165int,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=16402
# gear_intellect=13881
# gear_spirit=80
# gear_spell_power=6206
# gear_hit_rating=5093
# gear_crit_rating=5700
# gear_haste_rating=2869
# gear_mastery_rating=3531
# gear_armor=13783
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_snow_blossoms,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,weapon=sword_2.20speed_2260min_4198max,enchant=jade_spirit

Bamboozle

Bamboozle : 69853 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
69852.7 69852.7 132.75 / 0.19% 3428 / 4.9% 5541.8 12.6 12.4 Energy 9.01% 51.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Bamboozle/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#fb!200210
Glyphs
  • afterlife
  • fists_of_fury
  • spinning_crane_kick
  • rising_tiger_kick
  • crackling_tiger_lightning
  • zen_flight
Professions
  • jewelcrafting: 600
  • enchanting: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:112871|85989|62808|57089|26373|17821|13230&chds=0,225743&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E&chm=t++112871++rising_sun_kick,C79C6E,0,0,15|t++85989++fists_of_fury,C79C6E,1,0,15|t++62808++blackout_kick,C79C6E,2,0,15|t++57089++rushing_jade_wind,336600,3,0,15|t++26373++tiger_palm,C79C6E,4,0,15|t++17821++melee_main_hand,C79C6E,5,0,15|t++13230++jab,C79C6E,6,0,15&chtt=Bamboozle Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,20,18,13,7,6,4,3,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600&chl=melee_main_hand|blackout_kick|rising_sun_kick|fists_of_fury|tiger_strikes_melee|jab|blackout_kick_dot|tiger_palm|rushing_jade_wind|stormlash&chtt=Bamboozle Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:yz111122232535677776532100zzyxxwwvvvuuttssssssrrrrrrqqqqqqppppppqpqpppppoooooononnnnnnnmmmmlmlmmllllllllllmlmmmmnnnnnooooooooooooooooonnnnnnnnmmmmmmmmmlmlllllllllllllllllmmmmnnnnoooopppppppoooooonnnnnmnmmmmmmmlmlmllllllllllllmmlmmmmmmnnnnnoooooooooooooooonnnnnnnmmmmmmmmmmmmmmmmlmlmlmllllllmlmmmmnnnooppqrrrsstttuuuuuuuttssrrqqqqppoonnnnmmmmmmmmmmmmmmmmmmnnnnnnooooppppppppppppooooooonnnnmnmmmmmmmmmmmmmmmmmmmmmmmmnmnnnnnooopppppqqqqqqpqpppppoooonnnnnnnmnmnmnnnnnnnnnnnnnnnnonoooooopppqqqqrrrrrrqqqqqqppoonnnmmmmlllklklkkkklklkkklkklkllllllllkkjkkkkkkjkjkj&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6843,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=69853|max=102080&chxp=1,1,68,100&chtt=Bamboozle DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,0,3,0,1,3,2,7,7,13,17,24,24,38,41,34,53,63,55,53,67,60,54,51,52,43,44,51,40,19,19,14,13,10,5,4,1,5,3,2,1,0,1,0,0,0,0,1&chds=0,67&chbh=5&chxt=x&chxl=0:|min=62243|avg=69853|max=78738&chxp=0,1,46,100&chtt=Bamboozle DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:33.8,22.7,11.4,10.5,9.2,3.5,9.0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,ffffff&chl=jab 152.4s|blackout_kick 102.3s|rising_sun_kick 51.5s|fists_of_fury 47.3s|tiger_palm 41.6s|rushing_jade_wind 15.6s|waiting 40.6s&chtt=Bamboozle Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Bamboozle 69853
blackout_kick 14257 20.4% 95.3 4.66sec 67420 62808 52285 104832 67421 28.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.29 95.29 0.00 0.00 1.0734 0.0000 6424163.81 6424163.81 0.00 62808.35 62808.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.84 71.20% 52284.89 45728 58117 52292.29 51559 53075 3547114 3547114 0.00
crit 27.44 28.80% 104832.47 91457 116233 104844.13 102073 107579 2877050 2877050 0.00
DPS Timeline Chart

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combo_breaker_bok.react
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing ${8*$<low>} to ${8*$<high>} Physical damage.{$?s128595=false}[ If behind the target, you deal an additional {$m2=20}% damage over {$128531d=4 seconds}. If in front of the target, you are instantly healed for {$m2=20}% of the damage done.][] {$?s117967=false}[ Also causes you to gain Shuffle, increasing your parry chance by {$115307s1=20}% and your Stagger amount by an additional {$115307s2=20}% for {$115307d=6 seconds}.][]{$?s116645=false}[ Also empowers you with Serpent's Zeal, causing you and your summoned Jade Serpent Statue to heal nearby injured targets equal to {$127722m1=25}% of your auto-attack damage. Stacks up to 2 times.][]
blackout_kick_dot 2830 4.1% 95.2 4.66sec 13393 0 0 0 0 0.0% 0.0% 0.0% 0.0% 300.6 4242 0 4242 0.0% 0.0% 66.6%

Stats details: blackout_kick_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.21 95.21 300.59 300.59 0.0000 1.0000 1275169.84 1275169.84 0.00 4242.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 300.6 100.00% 4242.13 2286 12569 4245.50 3715 4926 1275170 1275170 0.00
DPS Timeline Chart

Action details: blackout_kick_dot

Static Values
  • id:128531
  • school:physical
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128531
  • name:Blackout Kick
  • school:physical
  • tooltip:$w1 damage every {$t1=1} sec.
  • description:{$@spelldesc100784=Kick with a blast of Chi energy, dealing ${8*$<low>} to ${8*$<high>} Physical damage.{$?s128595=false}[ If behind the target, you deal an additional {$m2=20}% damage over {$128531d=4 seconds}. If in front of the target, you are instantly healed for {$m2=20}% of the damage done.][] {$?s117967=false}[ Also causes you to gain Shuffle, increasing your parry chance by {$115307s1=20}% and your Stagger amount by an additional {$115307s2=20}% for {$115307d=6 seconds}.][]{$?s116645=false}[ Also empowers you with Serpent's Zeal, causing you and your summoned Jade Serpent Statue to heal nearby injured targets equal to {$127722m1=25}% of your auto-attack damage. Stacks up to 2 times.][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:5103.81
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
energizing_brew 0 0.0% 7.1 61.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: energizing_brew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 7.08 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: energizing_brew

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy.time_to_max>5
Spelldata
  • id:115288
  • name:Energizing Brew
  • school:physical
  • tooltip:Generating {$m1=10} Energy every {$t1=1} sec.
  • description:Regenerates $o1 Energy over {$d=6 seconds}. Can only be used while in combat.
fists_of_fury 9031 12.9% 12.9 35.14sec 315452 85989 0 0 0 29.6% 0.0% 0.0% 0.0% 64.3 49104 98463 63344 28.8% 0.0% 9.8%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 12.90 64.27 64.27 3.6686 0.6868 4070871.93 4070871.93 0.00 85988.59 85988.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.08 70.38% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.82 29.62% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.7 71.16% 49103.95 42870 54484 49112.90 47882 50486 2245903 2245903 0.00
crit 18.5 28.84% 98462.59 85741 108969 98475.60 95461 102646 1824969 1824969 0.00
DPS Timeline Chart

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.energizing_brew.up&energy.time_to_max>(cast_time)&buff.tiger_power.remains>(cast_time)
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w2 damage every {$t2=1} sec. {$?s125671=true}[Parrying all attacks.][]
  • description:Pummel all targets in front of you with rapid hand strikes, stunning them and dealing ${7.5*$<low>} to ${7.5*$<high>} damage immediately and every {$113656t2=1} sec for {$113656d=4 seconds}. Damage is spread evenly over all targets.{$?s125671=true}[ Your parry chance is increased by 100% while channeling.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: fists_of_fury_tick

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
jab 4474 6.4% 142.0 3.19sec 14202 13230 11004 22060 14201 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: jab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.99 141.99 0.00 0.00 1.0735 0.0000 2016473.48 2016473.48 0.00 13229.54 13229.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.92 71.08% 11003.85 9258 12244 11005.65 10866 11142 1110507 1110507 0.00
crit 41.07 28.92% 22059.60 18516 24487 22062.15 21690 22508 905967 905967 0.00
DPS Timeline Chart

Action details: jab

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.ascension.enabled&chi<=3
Spelldata
  • id:100780
  • name:Jab
  • school:physical
  • tooltip:
  • description:You Jab the target, dealing ${1.5*$<low>} to ${1.5*$<high>} damage and generating {$s2=1} Chi.
melee_main_hand 16063 23.0% 242.7 1.85sec 29824 17821 24231 48594 29824 28.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 242.71 242.71 0.00 0.00 1.6735 0.0000 7238642.76 7238642.76 0.00 17820.79 17820.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.07 47.00% 24230.92 20387 26928 24234.31 23907 24563 2764092 2764092 0.00
crit 70.20 28.92% 48594.16 40773 53856 48603.01 47745 49432 3411349 3411349 0.00
glance 58.44 24.08% 18192.96 15290 20196 18195.73 17881 18561 1063201 1063201 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.30
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rising_sun_kick 12900 18.5% 48.0 9.47sec 121154 112871 93783 187745 121158 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.01 48.01 0.00 0.00 1.0734 0.0000 5816379.74 5816379.74 0.00 112871.47 112871.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.02 70.87% 93782.80 79102 104610 93789.93 92100 95515 3190791 3190791 0.00
crit 13.98 29.13% 187744.69 158205 209220 187790.06 180528 196258 2625589 2625589 0.00
DPS Timeline Chart

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!target.debuff.rising_sun_kick.remains|target.debuff.rising_sun_kick.remains<=3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:You kick upwards, dealing ${14.4*$<low>} to ${14.4*$<high>} damage and applying Mortal Wounds to the target. Also causes all targets within $130320A1 yards to take an increased {$130320m1=15}% damage from your abilities for {$130320d=15 seconds}. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
rushing_jade_wind 1982 2.8% 14.6 31.65sec 61273 57089 56138 112489 61292 9.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rushing_jade_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 14.57 0.00 0.00 1.0733 0.0000 893215.70 893215.70 0.00 57089.08 57089.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.24 90.87% 56137.87 52037 68421 56162.38 53342 59124 743440 743440 0.00
crit 1.33 9.13% 112488.91 104074 136843 85886.52 0 136843 149776 149776 0.00
DPS Timeline Chart

Action details: rushing_jade_wind

Static Values
  • id:116847
  • school:nature
  • resource:chi
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.rushing_jade_wind.enabled
Spelldata
  • id:116847
  • name:Rushing Jade Wind
  • school:nature
  • tooltip:Damage taken by the Monk's Spinning Crane Kick increased by {$m2=30}%.
  • description:You summon a whirling tornado that travels $A1 yards in front of you, dealing {$s1=5069 to 6010} Nature damage to all targets in its path and increasing damage taken by your Spinning Crane Kick by {$m2=30}% for {$d=8 seconds}. |CFFFFFFFFBrewmaster|R Causes Shuffle when cast. |CFFFFFFFFMistweaver|R Increases the healing done by your Spinning Crane Kick by {$123664m1=50}% for {$123664d=12 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.825000
  • base_dd_min:5068.54
  • base_dd_max:6010.23
stormlash 1138 1.6% 56.1 5.81sec 8996 0 8248 16517 8996 9.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.06 56.06 0.00 0.00 0.0000 0.0000 504326.88 504326.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.99 90.95% 8247.79 4709 12731 8262.01 7177 9856 420564 420564 0.00
crit 5.07 9.05% 16516.85 9417 25462 16459.87 0 25462 83763 83763 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8163.98
  • base_dd_max:8163.98
tiger_palm 2434 3.5% 38.8 11.66sec 28307 26373 21934 43932 28305 29.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.79 38.79 0.00 0.00 1.0733 0.0000 1098163.78 1098163.78 0.00 26372.81 26372.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.56 71.03% 21934.12 19268 24487 21934.77 21374 22522 604433 604433 0.00
crit 11.24 28.97% 43932.44 38535 48975 43941.13 42475 45985 493730 493730 0.00
DPS Timeline Chart

Action details: tiger_palm

Static Values
  • id:100787
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.tiger_power.remains<=3
Spelldata
  • id:100787
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing ${3*$<low>} to ${3*$<high>} damage. Also grants you Tiger Power, causing your attacks to ignore {$125359m1=30}% of enemies' armor for {$125359d=20 seconds}.
tiger_strikes_melee 4745 6.8% 68.0 6.06sec 31412 0 24266 48655 31411 29.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_strikes_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.04 68.04 0.00 0.00 0.0000 0.0000 2137140.07 2137140.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.10 70.70% 24265.90 20387 26928 24268.05 23630 25437 1167250 1167250 0.00
crit 19.93 29.30% 48654.60 40773 53856 48665.89 47175 51390 969890 969890 0.00
DPS Timeline Chart

Action details: tiger_strikes_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tigereye_brew 0 0.0% 10.2 42.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigereye_brew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.20 10.20 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigereye_brew

Static Values
  • id:116740
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
Spelldata
  • id:116740
  • name:Tigereye Brew
  • school:physical
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by {$m1=2}% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts {$d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.30%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
combo_breaker_bok 29.8 0.0 14.9sec 14.9sec 12.26% 30.93%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_combo_breaker_bok
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • combo_breaker_bok_1:12.26%

Trigger Attempt Success

  • trigger_pct:20.97%

Spelldata details

  • id:116768
  • name:Combo Breaker: Blackout Kick
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:{$@spelldesc115636=Grants a {$s1=0}% chance for Jab to cause your next Tiger Palm to cost no Chi, or your next Blackout Kick to cost no Chi.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
combo_breaker_tp 29.0 1.1 15.3sec 14.7sec 15.10% 73.93%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_combo_breaker_tp
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • combo_breaker_tp_1:15.10%

Trigger Attempt Success

  • trigger_pct:21.16%

Spelldata details

  • id:118864
  • name:Combo Breaker: Tiger Palm
  • tooltip:Your next Tiger Palm costs no Chi.
  • description:{$@spelldesc115636=Grants a {$s1=0}% chance for Jab to cause your next Tiger Palm to cost no Chi, or your next Blackout Kick to cost no Chi.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
dancing_steel 13.9 16.3 32.9sec 14.7sec 55.86% 56.04%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:55.86%

    Trigger Attempt Success

    • trigger_pct:2.98%
energizing_brew 7.1 0.0 61.2sec 61.2sec 9.35% 9.35%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_energizing_brew
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • energizing_brew_1:9.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115288
  • name:Energizing Brew
  • tooltip:Generating {$m1=10} Energy every {$t1=1} sec.
  • description:Regenerates $o1 Energy over {$d=6 seconds}. Can only be used while in combat.
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:101.00%
hawkmasters_talon 7.9 0.0 60.8sec 60.8sec 25.93% 25.93%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:hawkmasters_talon_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:3595.00

    Stack Uptimes

    • hawkmasters_talon_1:25.93%

    Trigger Attempt Success

    • trigger_pct:100.00%
power_strikes 22.5 0.0 20.0sec 20.0sec 8.24% 15.81%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_power_strikes
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_strikes_1:8.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:129914
  • name:Power Strikes
  • tooltip:Your next Jab, Soothing Mist, or Crackling Jade Lightning will generate {$s1=1} additional Chi. If you are already at maximum Chi, a Chi Sphere will be summoned near you.
  • description:{$@spelldesc121817=Every {$t1=20} sec, you gain Power Strikes, causing your next Jab, Soothing Mist, or Crackling Jade Lightning to generate {$s1=1} additional Chi. If you are already at maximum Chi, a Chi Sphere will be summoned near you.}
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_niuzao 7.6 0.0 60.9sec 60.9sec 20.02% 20.02%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:relic_of_niuzao_trinket1
  • max_stacks:1
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:dodge_rating
    • amount:8871.00

    Stack Uptimes

    • relic_of_niuzao_1:20.02%

    Trigger Attempt Success

    • trigger_pct:100.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tiger_power 2.1 36.7 175.9sec 11.7sec 99.04% 98.88%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_tiger_power
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • tiger_power_1:99.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:125359
  • name:Tiger Power
  • tooltip:Your attacks ignore {$m1=30}% armor.
  • description:{$@spelldesc100787=Attack with the palm of your hand, dealing ${3*$<low>} to ${3*$<high>} damage. Also grants you Tiger Power, causing your attacks to ignore {$125359m1=30}% of enemies' armor for {$125359d=20 seconds}.}
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
tiger_strikes 15.1 4.3 28.7sec 22.0sec 20.63% 27.00%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_tiger_strikes
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:0.00

Stack Uptimes

  • tiger_strikes_1:4.51%
  • tiger_strikes_2:4.91%
  • tiger_strikes_3:5.34%
  • tiger_strikes_4:5.88%

Trigger Attempt Success

  • trigger_pct:7.96%

Spelldata details

  • id:120273
  • name:Tiger Strikes
  • tooltip:Attack speed increased by {$s1=50}%, and the next $n autoattacks cause an extra attack.
  • description:{$@spelldesc120272=You have a $h1% chance to gain Tiger Strikes when you autoattack, increasing your attack speed by {$120273s1=50}% and causing your next $120273n autoattacks to cause an extra attack.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tigereye_brew 11.1 95.9 42.0sec 4.2sec 92.54% 100.00%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_tigereye_brew
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • tigereye_brew_1:10.14%
  • tigereye_brew_2:10.22%
  • tigereye_brew_3:10.17%
  • tigereye_brew_4:10.05%
  • tigereye_brew_5:9.98%
  • tigereye_brew_6:9.87%
  • tigereye_brew_7:9.75%
  • tigereye_brew_8:9.61%
  • tigereye_brew_9:9.56%
  • tigereye_brew_10:3.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:125195
  • name:Tigereye Brew
  • tooltip:Use Tigereye Brew to consume charges to gain 2% damage per charge.
  • description:{$@spelldesc123980=For each {$m1=4} Chi you consume through use of abilities and attacks, you gain a charge of Tigereye Brew. Use Tigereye Brew to consume the charges. Tigereye Brew can stack up to {$125195u=10} times.}
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
tigereye_brew_use 10.2 0.0 42.5sec 42.5sec 33.27% 33.27%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_tigereye_brew_use
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • tigereye_brew_use_1:33.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116740
  • name:Tigereye Brew
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by {$m1=2}% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
virmens_bite_potion 1.0 0.0 395.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Bamboozle
blackout_kick Chi 95.3 131.3 1.4 1.4 48926.6
fists_of_fury Chi 12.9 38.7 3.0 3.0 105149.7
jab Energy 142.0 5679.5 40.0 40.0 355.0
rising_sun_kick Chi 48.0 96.0 2.0 2.0 60579.7
rushing_jade_wind Chi 14.6 29.2 2.0 2.0 30635.7
tiger_palm Chi 38.8 10.0 0.3 0.3 110168.9
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1803.90 5194.69 (92.52%) 2.88 37.73 0.72%
chi Chi 141.99 306.43 (77.67%) 2.16 0.00 0.00%
combo_breaker_savings Chi 58.46 88.10 (22.33%) 1.51 0.00 0.00%
energizing_brew Energy 168.72 419.71 (7.48%) 2.49 2.10 0.50%
Resource RPS-Gain RPS-Loss
Energy 12.45 12.59
Chi 0.68 0.68
Combat End Resource Mean Min Max
Health 436441.00 436441.00 436441.00
Mana 300000.00 300000.00 300000.00
Energy 34.88 0.21 100.00
Chi 1.28 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.6%
xuen_the_white_tiger-Energy Cap 0.6%

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Bamboozle Damage Per Second
Count 999
Mean 69852.72
Minimum 62243.25
Maximum 78738.41
Spread ( max - min ) 16495.16
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 2140.7163
5th Percentile 66489.87
95th Percentile 73346.73
( 95th Percentile - 5th Percentile ) 6856.85
Mean Distribution
Standard Deviation 67.7293
95.00% Confidence Intervall ( 69719.97 - 69985.46 )
Normalized 95.00% Confidence Intervall ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3607
0.1 Scale Factor Error with Delta=300 39120
0.05 Scale Factor Error with Delta=300 156481
0.01 Scale Factor Error with Delta=300 3912027
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 69852.72
Distribution Chart

Damage

Sample Data
Count 999
Mean 31474548.00
Distribution Chart

DTPS

Sample Data Bamboozle Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Bamboozle Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Bamboozle Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 386.39
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 stance
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 0.00 chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 7.92 use_item,name=hawkmasters_talon
9 7.63 use_item,name=relic_of_niuzao
A 0.00 chi_brew,if=talent.chi_brew.enabled&chi=0
B 5.43 rising_sun_kick,if=!target.debuff.rising_sun_kick.remains|target.debuff.rising_sun_kick.remains<=3
C 13.48 tiger_palm,if=buff.tiger_power.remains<=3
D 10.20 tigereye_brew,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
E 7.08 energizing_brew,if=energy.time_to_max>5
F 0.00 invoke_xuen,if=talent.invoke_xuen.enabled
G 14.58 rushing_jade_wind,if=talent.rushing_jade_wind.enabled
H 0.00 run_action_list,name=aoe,if=active_enemies>=5
I 0.00 run_action_list,name=st,if=active_enemies<5
actions.st
# count action,conditions
L 42.58 rising_sun_kick
M 12.90 fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>(cast_time)&buff.tiger_power.remains>(cast_time)
N 28.91 blackout_kick,if=buff.combo_breaker_bok.react
O 1.94 blackout_kick,if=(chi>=3&energy.time_to_max<=2&!talent.ascension.enabled)|(chi>=4&energy.time_to_max<=2&talent.ascension.enabled)
P 25.31 tiger_palm,if=(buff.combo_breaker_tp.react&energy.time_to_max>=2)|(buff.combo_breaker_tp.remains=0&buff.combo_breaker_tp.react)
Q 0.00 jab,if=talent.ascension.enabled&chi<=3
R 0.00 jab,if=talent.chi_brew.enabled&chi<=2
S 141.99 jab,if=talent.power_strikes.enabled&((chi<=1&!cooldown.power_strikes.remains)|(chi<=2&cooldown.power_strikes.remains))
T 64.44 blackout_kick,if=((energy+(energy.regen*(cooldown.rising_sun_kick.remains)))>=40)|(chi=4&!talent.ascension.enabled)|(chi=5&talent.ascension.enabled)

Sample Sequence

58SBSCSGSMSLNSP9OSOSLSTOSTSTSLPSMSGDSLNSTSPTSLSETSTTSTSLNS8PTSTSLPSGSMS9LDSPTSNTSLSTSPLSTSMSGSBSCESTTSLSPTS8PTSLSNDTSTSMS9BCNSGSLSPTSTSLSNMSLSCSTDTSEGLNSTSTSP8LSTSTSLSMPS9TSLSTSGSLSTCSNDLSTSLSPTSMSEGSBSTS8TSTSCSBPSTTS9LSTSPGSLSMDSLSTTSCSLSTSPLTSEGSTSP8LSTSTSPLSMST9DSLNSTSCSGSBTSNTSLSCSMPSBPSTSETSGS8LPSTSNDTSLNTSTSN9TSCLSTSTSGNSBNS7CDTSPLSTSLSMSNCLSEG8STSTSLSTSTSNCLS9NDTSPTSLSTSGS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 183 174 80
Agility 16568 14414 13618
Stamina 20717 18834 18720
Intellect 260 248 80
Spirit 272 272 80
Health 436441 410079 0
Mana 300000 300000 0
Energy 100 100 0
Chi 4 4 0
Spell Power 0 0 0
Spell Hit 22.82% 22.82% 2559
Spell Crit 12.16% 7.16% 3125
Spell Haste 16.38% 10.84% 4605
ManaReg per Second 1200 1200 0
Attack Power 36816 29152 0
Melee Hit 7.53% 7.53% 2559
Melee Crit 30.84% 24.13% 3125
Melee Haste 10.84% 10.84% 4605
Swing Speed 70.69% 55.17% 4605
Expertise 15.29% 15.29% 5199
Armor 17871 17871 17521
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 21.03% 14.03% 1209

Talents

Level
15 Celerity Tiger's Lust Momentum
30 Chi Wave Zen Sphere Chi Burst
45 Power Strikes Ascension Chi Brew
60 Deadly Reach Charging Ox Wave Leg Sweep
75 Healing Elixirs Dampen Harm Diffuse Magic
90 Rushing Jade Wind Invoke Xuen, the White Tiger Chi Torpedo

Profile

#!./simc

monk="Bamboozle"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Bamboozle/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/86/70987862-avatar.jpg"
level=90
race=unknown
spec=windwalker
role=hybrid
position=back
professions=jewelcrafting=600/enchanting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fb!200210
glyphs=afterlife/fists_of_fury/spinning_crane_kick/rising_tiger_kick/crackling_tiger_lightning/zen_flight

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/stance
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=auto_attack
actions+=/chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
actions+=/virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/use_item,name=hawkmasters_talon
actions+=/use_item,name=relic_of_niuzao
actions+=/chi_brew,if=talent.chi_brew.enabled&chi=0
actions+=/rising_sun_kick,if=!target.debuff.rising_sun_kick.remains|target.debuff.rising_sun_kick.remains<=3
actions+=/tiger_palm,if=buff.tiger_power.remains<=3
actions+=/tigereye_brew,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions+=/energizing_brew,if=energy.time_to_max>5
actions+=/invoke_xuen,if=talent.invoke_xuen.enabled
actions+=/rushing_jade_wind,if=talent.rushing_jade_wind.enabled
actions+=/run_action_list,name=aoe,if=active_enemies>=5
actions+=/run_action_list,name=st,if=active_enemies<5

actions.aoe=rising_sun_kick,if=chi=4
actions.aoe+=/spinning_crane_kick

actions.st=rising_sun_kick
actions.st+=/fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>(cast_time)&buff.tiger_power.remains>(cast_time)
actions.st+=/blackout_kick,if=buff.combo_breaker_bok.react
actions.st+=/blackout_kick,if=(chi>=3&energy.time_to_max<=2&!talent.ascension.enabled)|(chi>=4&energy.time_to_max<=2&talent.ascension.enabled)
actions.st+=/tiger_palm,if=(buff.combo_breaker_tp.react&energy.time_to_max>=2)|(buff.combo_breaker_tp.remains=0&buff.combo_breaker_tp.react)
actions.st+=/jab,if=talent.ascension.enabled&chi<=3
actions.st+=/jab,if=talent.chi_brew.enabled&chi<=2
actions.st+=/jab,if=talent.power_strikes.enabled&((chi<=1&!cooldown.power_strikes.remains)|(chi<=2&cooldown.power_strikes.remains))
actions.st+=/blackout_kick,if=((energy+(energy.regen*(cooldown.rising_sun_kick.remains)))>=40)|(chi=4&!talent.ascension.enabled)|(chi=5&talent.ascension.enabled)

head=crown_of_opportunistic_strikes,id=86146,gems=austere_primal_320agi_180agi,reforge=crit_exp
neck=amulet_of_the_hidden_kings,id=86047,reforge=haste_hit
shoulders=imperion_spaulders,id=89341,gems=160exp_160haste_60agi,enchant=200agi_100crit,reforge=crit_exp
back=blackguard_cape,id=89076,enchant=180hit,reforge=mastery_exp
chest=chestguard_of_total_annihilation,id=86136,gems=320exp_160exp_160haste_120agi,enchant=80all,reforge=crit_exp
shirt=blue_linen_shirt,id=2577
wrists=bracers_of_unseen_strikes,id=86163,enchant=180agi,reforge=crit_exp
hands=bonebreaker_gauntlets,id=86176,gems=160exp_160hit_60haste,enchant=170exp
waist=tomb_raiders_girdle,id=85982,gems=160exp_160haste_160haste_120sta_320exp_120exp
legs=stoneflesh_leggings,id=87013,gems=320agi_160haste_120sta_120agi,enchant=285agi_165crit,reforge=crit_hit
feet=boots_of_raging_haze,id=90914,enchant=140agi,reforge=mastery_exp
finger1=fengs_seal_of_binding,id=89967,enchant=160agi,reforge=mastery_exp
finger2=seal_of_ghoulish_glee,id=88168,enchant=160agi,reforge=crit_haste
trinket1=relic_of_niuzao,id=79329
trinket2=hawkmasters_talon,id=89082
main_hand=gaorei_staff_of_the_legendary_protector,id=86879,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=13618
# gear_stamina=18720
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=5199
# gear_hit_rating=2559
# gear_crit_rating=3125
# gear_haste_rating=4605
# gear_mastery_rating=1209
# gear_armor=17521
# meta_gem=austere_primal
# main_hand=gaorei_staff_of_the_legendary_protector,weapon=staff_3.30speed_10450min_15675max,enchant=dancing_steel

Wongfeihung

Wongfeihung : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Energy 0.00% 0.0 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Wongfeihung/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#fZ!021201
Glyphs
  • mana_tea
  • renewing_mist
  • spinning_crane_kick
  • spirit_roll
  • water_roll
  • zen_flight
Professions
  • inscription: 600
  • enchanting: 600

Charts

http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|&chxp=1,1,-nan,100&chtt=Wongfeihung DPS Timeline&chts=dddddd,18

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.02%

Buff details

  • buff initial source:Wongfeihung
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Wongfeihung
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Wongfeihung
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1803.90 0.00 (-nan%) 0.00 5454.87 100.00%
Resource RPS-Gain RPS-Loss
Combat End Resource Mean Min Max
Health 394217.00 394217.00 394217.00
Mana 300000.00 300000.00 300000.00
Energy 100.00 100.00 100.00
Chi 0.00 0.00 0.00
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Wongfeihung Damage Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 999
Mean 0.00
Distribution Chart

DTPS

Sample Data Wongfeihung Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Wongfeihung Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Wongfeihung Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 94 0
Agility 0 111 0
Stamina 0 16092 15978
Intellect 0 15121 14234
Spirit 0 9600 9408
Health 0 371691 0
Mana 0 300000 0
Energy 0 100 0
Chi 0 5 0
Spell Power 0 6206 6206
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 13.85% 3621
Spell Haste inf% 2.45% 1043
ManaReg per Second 0 1200 0
Attack Power 0 466 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% 13.60% 3621
Melee Haste inf% 2.45% 1043
Swing Speed inf% 43.44% 1043
Expertise 0.00% 0.00% 0
Armor 0 17165 17165
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 15.18% 2788

Talents

Level
15 Celerity Tiger's Lust Momentum
30 Chi Wave Zen Sphere Chi Burst
45 Power Strikes Ascension Chi Brew
60 Deadly Reach Charging Ox Wave Leg Sweep
75 Healing Elixirs Dampen Harm Diffuse Magic
90 Rushing Jade Wind Invoke Xuen, the White Tiger Chi Torpedo

Profile

#!./simc

monk="Wongfeihung"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Wongfeihung/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/192/70980288-avatar.jpg"
level=90
race=unknown
spec=mistweaver
role=hybrid
position=back
professions=enchanting=600/inscription=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fZ!021201
glyphs=mana_tea/renewing_mist/spinning_crane_kick/spirit_roll/water_roll/zen_flight

head=red_crane_helm,id=86730,gems=revitalizing_primal_320spi_180int,reforge=mastery_crit
neck=zians_choker_of_coalesced_shadow,id=86083,reforge=mastery_haste
shoulders=spaulders_of_the_divided_mind,id=86768,gems=80int_160spi_60int,enchant=520int_100crit,reforge=mastery_crit
back=cape_of_three_lanterns,id=85979,enchant=180int
chest=robes_of_eighty_lights,id=86180,gems=80int_160spi_80int_160haste_120int,enchant=200spi
wrists=bracers_of_dark_thoughts,id=86127,enchant=170mastery
hands=rattling_gloves,id=82827,enchant=170mastery,reforge=haste_crit
waist=klaxxi_lash_of_the_harbinger,id=89061,gems=320spi_320spi_60spi
legs=windreaver_greaves,id=89089,gems=320spi,enchant=285int_165spi,reforge=mastery_crit
feet=asanis_uncleansed_sandals,id=86878,gems=320spi,enchant=140mastery,reforge=haste_crit
finger1=wicked_witchs_signet,id=88166,enchant=160int
finger2=circuit_of_the_frail_soul,id=86038,enchant=160int
trinket1=jade_courtesan_figurine,id=86045
trinket2=relic_of_chiji,id=79330
main_hand=kritak_imperial_scepter_of_the_swarm,id=86865,enchant=windsong
off_hand=inscribed_red_fan,id=79335,enchant=165int,reforge=mastery_haste

# Gear Summary
# gear_stamina=15978
# gear_intellect=14234
# gear_spirit=9408
# gear_spell_power=6206
# gear_crit_rating=3621
# gear_haste_rating=1043
# gear_mastery_rating=2788
# gear_armor=17165
# meta_gem=revitalizing_primal
# main_hand=kritak_imperial_scepter_of_the_swarm,weapon=mace_2.40speed_2466min_4580max,enchant=windsong

Sagefraise

Sagefraise : 89551 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
89551.0 89551.0 130.24 / 0.15% 3528 / 3.9% 67.0 1276.5 1273.4 Mana 5.78% 46.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Sagefraise/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#bb!200112
Glyphs
  • mass_exorcism
  • templars_verdict
  • divine_protection
  • contemplation
  • fire_from_the_heavens
  • winged_vengeance
Professions
  • alchemy: 600
  • inscription: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:219809|70641|64924|51924|40441|23525|9590&chds=0,439618&chco=FFE57F,FFE57F,C79C6E,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++219809++execution_sentence,FFE57F,0,0,15|t++70641++hammer_of_wrath,FFE57F,1,0,15|t++64924++templars_verdict,C79C6E,2,0,15|t++51924++exorcism,FFE57F,3,0,15|t++40441++judgment,FFE57F,4,0,15|t++23525++crusader_strike,C79C6E,5,0,15|t++9590++melee,C79C6E,6,0,15&chtt=Sagefraise Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,14,14,11,10,9,8,6,6,5,5,2,0&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,C79C6E,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E,336600,FFE57F&chl=hand_of_light|hammer_of_wrath|templars_verdict|melee|censure|judgment|exorcism|seal_of_truth_proc|execution_sentence|crusader_strike|guardian_of_ancient_kings: melee|stormlash|ancient_fury&chtt=Sagefraise Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:gjlnosuvvwxz02468665430zxxtromlihfecbaZYWVUUTSRRQQQQPPPOOOOOOPPPPQQQQQQQQRRRRRSSRRQQQPONNNNNNNNNNNNNNNNOOOPPPPQQQRRRRRRRSSTTUUWWXXYYYYYYYZaZaZZYXXWVUUTTSSSRRQQQPPPPPPPPPPPPPPPOOONONNONOOOOPPPPPPPQQQRRRRRRRQQPPOOOOOOOOOOOOOOOOOOPPQQRRSSSSSTSTTUUVVWWXYYYZZZZZZZZZZZYYXXWVUTSRQQPPOOOOOOOOOOOOOOOOOOOOOOOOOPPPPPQQRRRSSSTTTTTTTUTTTTSSRRQQQPPPPPPPPQQRSTVWXYZbcdefghiijkkllllmmmnnnmlkjihhgfedcbZYXVUSRQQQQQQQQQQQQQQQRRRRRRRRRRRRRRRQRRRRRRSSSSSTTTTTTUUUUUUTTTSSSRRRRRSSSSTTTTUUVVWWWWXXXXXXXXWXWWWWWWWWWWWWWWVVWWVVVVUUUTTTSSRRRRRRRRRRRRRRRRRRRRRRRRRRRRQPPPPPPPPOOOO&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3553,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=89551|max=252053&chxp=1,1,36,100&chtt=Sagefraise DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,2,1,4,1,5,6,14,10,13,23,14,22,28,41,38,46,54,45,38,55,55,49,61,46,42,46,39,31,28,23,17,18,15,6,14,13,11,5,3,1,4,2,3,4,1,0,0,1&chds=0,61&chbh=5&chxt=x&chxl=0:|min=83374|avg=89551|max=96858&chxp=0,1,46,100&chtt=Sagefraise DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.7,18.7,18.5,17.2,13.7,4.3,2.2,5.8&chds=0,100&chdls=ffffff&chco=C79C6E,FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=crusader_strike 88.8s|judgment 84.4s|templars_verdict 83.5s|hammer_of_wrath 77.6s|exorcism 61.8s|inquisition 19.5s|execution_sentence 10.0s|waiting 26.1s&chtt=Sagefraise Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Sagefraise 89551
ancient_fury 392 0.4% 1.8 347.10sec 95854 0 79210 162660 95882 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.85 1.85 0.00 0.00 0.0000 0.0000 177027.93 177027.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.48 80.05% 79210.18 74965 101588 73675.08 0 101588 117101 117101 0.00
crit 0.37 19.95% 162659.63 154428 209272 53519.83 0 209272 59927 59927 0.00
DPS Timeline Chart

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86704
  • name:Ancient Fury
  • school:holy
  • tooltip:
  • description:Unleash the fury of ancient kings, causing {$s1=230 to 311} Holy damage per application of Ancient Power, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.107000
  • base_dd_min:229.65
  • base_dd_max:310.71
arcane_torrent 0 0.0% 4.3 120.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=2}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
avenging_wrath 0 0.0% 4.4 115.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.42 4.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:115.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
censure 8528 9.5% 358.1 1.26sec 10732 0 0 0 0 0.0% 0.0% 0.0% 0.0% 188.7 16468 34033 20360 22.2% 0.0% 99.4%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 358.06 358.06 188.74 188.74 0.0000 2.3765 3842730.91 3842730.91 0.00 8567.08 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 358.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.9 77.84% 16468.45 7490 30189 16479.95 15867 17253 2419587 2419587 0.00
crit 41.8 22.16% 34032.80 15429 62189 34052.07 30776 38328 1423144 1423144 0.00
DPS Timeline Chart

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every {$t1=3} sec.
  • description:Deals ${{$m1=0}*5} additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:107.34
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
crusader_strike 4635 5.2% 66.3 6.72sec 31514 23525 25606 52760 31513 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.32 66.32 0.00 0.00 1.3396 0.0000 2089904.62 2089904.62 0.00 23524.90 23524.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.89 78.24% 25605.82 24089 39218 25608.49 24952 26335 1328647 1328647 0.00
crit 14.43 21.76% 52760.13 49623 80790 52766.54 49623 57611 761257 761257 0.00
DPS Timeline Chart

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8999.0
  • cooldown:3.87
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}[An instant strike that causes {$m2=125}% weapon damage plus {$m1=1} and grants a charge of Holy Power.][An instant strike that causes {$m2=125}% weapon damage plus {$m1=1}.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:632.63
  • base_dd_max:632.63
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
execution_sentence 4892 5.5% 7.8 61.01sec 283268 219809 0 0 0 0.0% 0.0% 0.0% 0.0% 77.1 23584 48204 28634 20.5% 0.0% 17.1%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 7.79 77.08 77.08 1.2887 1.0000 2206881.33 2206881.33 0.00 25332.38 219808.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.3 79.49% 23583.75 7168 172690 23568.25 15516 28841 1445022 1445022 0.00
crit 15.8 20.51% 48203.67 14766 355742 47957.75 23965 107895 761860 761860 0.00
DPS Timeline Chart

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*{$114916m2=5936}/1000+26.72716306*{$114916m1=1}} Holy damage over {$114916d=10 seconds}. This damage is dealt slowly at first and increases over time, culminating in a final burst of damage.} |CFFFFFFFFStay of Execution|R If used on friendly targets, the falling hammer heals the target for ${$SPH*{$114917m2=5936}/1000+26.72716306*{$114917m1=1}} healing over {$114917d=10 seconds}. This healing is dealt slowly at first and increases over time, culminating in a final burst of healing.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.222096
  • base_td:486.46
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
exorcism 7127 8.0% 48.6 9.30sec 66011 51924 54360 112829 66009 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.62 48.62 0.00 0.00 1.2713 0.0000 3209438.02 3209438.02 0.00 51924.25 51924.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.93 80.07% 54359.53 34755 95846 54391.75 50719 59114 2116073 2116073 0.00
crit 9.69 19.93% 112828.81 71596 197443 112842.49 96569 163324 1093365 1093365 0.00
DPS Timeline Chart

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:12.88
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Forcefully attempt to expel the evil from the target with a blast of Holy Light. Causes {$s1=6577 to 7343} Holy damage and generates a charge of Holy Power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.677000
  • base_dd_min:6577.24
  • base_dd_max:7342.84
guardian_of_ancient_kings 0 0.0% 2.0 347.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: guardian_of_ancient_kings

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: guardian_of_ancient_kings

Static Values
  • id:86698
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.avenging_wrath.up
Spelldata
  • id:86698
  • name:Guardian of Ancient Kings
  • school:holy
  • tooltip:Protected by a Guardian of Ancient Kings. Attacks by you and your Guardian infuse you with Ancient Power and unleash Ancient Fury when your Guardian departs.
  • description:Summons a Guardian of Ancient Kings to help you deal damage for {$d=30 seconds}. The Guardian of Ancient Kings will attack your current enemy. Both your attacks and the attacks of the Guardian will infuse you with Ancient Power that is unleashed as Ancient Fury when the Guardian departs.
hammer_of_wrath 12173 13.6% 60.0 7.50sec 91420 70641 73907 152446 91445 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.98 59.96 0.00 0.00 1.2941 0.0000 5483352.09 5483352.09 0.00 70640.82 70640.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.58 77.67% 73907.12 38025 113765 73995.17 68002 80318 3442289 3442289 0.00
crit 13.39 22.33% 152446.00 78331 234356 152648.55 118686 186315 2041063 2041063 0.00
DPS Timeline Chart

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1799.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1747 to 1930} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1746.58
  • base_dd_max:1930.43
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
hand_of_light 12392 13.8% 189.5 2.38sec 29472 0 29471 0 29471 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.48 189.48 0.00 0.00 0.0000 0.0000 5584217.22 5584217.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.48 100.00% 29471.39 7772 113096 29494.02 26560 33042 5584217 5584217 0.00
DPS Timeline Chart

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:121375.67
  • base_dd_max:121375.67
inquisition 0 0.0% 15.2 30.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 15.20 0.00 0.00 1.2803 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by {$s1=30}% and critical strike chance by {$s3=10}%. Lasts {$d=10 seconds} per charge of Holy Power consumed.
judgment 7576 8.5% 63.5 7.11sec 53782 40441 43404 89903 53779 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.47 63.47 0.00 0.00 1.3299 0.0000 3413556.57 3413556.57 0.00 40440.67 40440.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.31 77.68% 43404.42 27522 83585 43435.42 40885 46399 2140084 2140084 0.00
crit 14.16 22.32% 89903.31 56696 172184 89954.68 74625 109992 1273473 1273473 0.00
DPS Timeline Chart

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:5.15
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=20|buff.avenging_wrath.up
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:A magic attack that unleashes the energy of a Seal to cause {$s1=623} Holy damage{$?s105424=false}[ and generates one charge of Holy Power.]?s111529[, generate one charge of Holy Power, and apply the Physical Vulnerability debuff to a target. |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by {$81326s1=4}% for {$81326d=30 seconds}.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:623.49
  • base_dd_max:623.49
melee 9564 10.7% 165.1 2.72sec 26113 9590 22250 45867 26114 22.0% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.07 165.07 0.00 0.00 2.7230 0.0000 4310491.51 4310491.51 0.00 9589.80 9589.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.52 54.23% 22249.70 19422 32306 22259.32 21333 23171 1991832 1991832 0.00
crit 36.24 21.95% 45867.37 40009 66550 45878.13 42945 49938 1662163 1662163 0.00
glance 39.31 23.82% 16699.89 14566 24229 16707.84 15798 18273 656497 656497 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rebuke 0 0.0% 1.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.03 1.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:7019.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
seal_of_truth_proc 4952 5.5% 358.1 1.26sec 6234 0 5044 10428 6234 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 358.06 358.06 0.00 0.00 0.0000 0.0000 2232229.25 2232229.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.88 77.89% 5043.64 3465 7492 5045.56 4941 5151 1406603 1406603 0.00
crit 79.17 22.11% 10428.37 7137 15434 10430.31 9948 10951 825626 825626 0.00
DPS Timeline Chart

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:9839.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal {$42463s1=0}% additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals ${{$m1=0}*5} additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.12
stormlash 1375 1.5% 43.5 7.53sec 14011 0 11490 23774 14011 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.47 43.47 0.00 0.00 0.0000 0.0000 609113.64 609113.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.55 79.48% 11489.64 4491 19190 11487.76 9634 13145 396993 396993 0.00
crit 8.92 20.52% 23773.59 9251 39531 23803.72 9251 38020 212120 212120 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:9190.72
  • base_dd_max:9190.72
templars_verdict 12031 13.4% 63.2 7.00sec 85813 64924 69318 143120 85811 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.20 63.20 0.00 0.00 1.3217 0.0000 5423115.44 5423115.44 0.00 64924.16 64924.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.07 77.65% 69318.11 60932 99208 69350.30 66629 72060 3401688 3401688 0.00
crit 14.12 22.35% 143119.70 125520 204368 143120.13 129321 163117 2021428 2021428 0.00
DPS Timeline Chart

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:physical
  • tooltip:
  • description:A powerful weapon strike that consumes 3 charges of Holy Power to deal {$s1=3}% weapon damage plus {$s2=628}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:628.06
  • base_dd_max:628.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
pet - guardian_of_ancient_kings 30154 / 3914
melee 30154 4.3% 44.0 8.70sec 39764 29386 42292 0 39765 0.0% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.99 43.99 0.00 0.00 1.3532 0.0000 1749158.48 1749158.48 0.00 29386.26 29386.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.38 75.88% 42291.63 28685 51790 42259.93 37442 45214 1411563 1411563 0.00
glance 10.61 24.12% 31813.26 21514 38843 31789.61 27084 38843 337596 337596 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 220.7 347.1sec 1.7sec 12.99% 100.00%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_ancient_power
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • ancient_power_1:0.07%
  • ancient_power_2:0.01%
  • ancient_power_3:0.15%
  • ancient_power_4:0.26%
  • ancient_power_5:0.07%
  • ancient_power_6:0.10%
  • ancient_power_7:0.26%
  • ancient_power_8:0.05%
  • ancient_power_9:0.03%
  • ancient_power_10:0.11%
  • ancient_power_11:0.16%
  • ancient_power_12:0.06%
  • ancient_power_13:0.11%
  • ancient_power_14:0.16%
  • ancient_power_15:0.15%
  • ancient_power_16:0.06%
  • ancient_power_17:0.14%
  • ancient_power_18:0.16%
  • ancient_power_19:0.04%
  • ancient_power_20:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:86700
  • name:Ancient Power
  • tooltip:Strength increased by {$s1=1}%. When Guardian of Ancient Kings departs, the Paladin releases Ancient Fury, causing Holy damage split among all enemies within $86704a1 yards.
  • description:Strength increased by {$s1=1}%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing {$86704s1=230 to 311} Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.4 0.0 115.7sec 115.7sec 28.47% 31.80%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:28.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.20%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
inquisition 5.2 10.0 80.9sec 30.4sec 97.54% 99.03%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inquisition_1:97.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by {$s1=30}% and critical strike chance by {$s3=10}%. Lasts {$d=10 seconds} per charge of Holy Power consumed.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
lei_shens_final_orders 9.0 0.0 52.1sec 52.1sec 39.24% 39.24%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_lei_shens_final_orders
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:3236.00

    Stack Uptimes

    • lei_shens_final_orders_1:39.24%

    Trigger Attempt Success

    • trigger_pct:16.12%
mogu_power_potion 1.0 0.0 349.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
relic_of_xuen 9.4 0.0 50.3sec 50.3sec 30.69% 30.69%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:30.69%

    Trigger Attempt Success

    • trigger_pct:21.05%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
windsong_crit 5.6 1.0 71.3sec 58.3sec 16.05% 16.12%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:16.05%

    Trigger Attempt Success

    • trigger_pct:3.59%
windsong_haste 5.7 1.0 69.5sec 57.1sec 16.33% 16.54%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:16.33%

    Trigger Attempt Success

    • trigger_pct:3.66%
windsong_mastery 5.7 1.0 69.6sec 57.4sec 16.41% 16.35%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:16.41%

    Trigger Attempt Success

    • trigger_pct:3.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Sagefraise
crusader_strike Mana 66.3 119357.3 1799.8 1799.8 17.5
exorcism Mana 48.6 116683.2 2400.0 2399.9 27.5
hammer_of_wrath Mana 60.0 107900.4 1799.0 1798.9 50.8
inquisition Holy Power 15.2 45.6 3.0 3.0 0.0
judgment Mana 63.5 224687.3 3540.0 3540.0 15.2
rebuke Mana 1.0 7208.5 7019.0 7018.8 0.0
templars_verdict Holy Power 63.2 189.6 3.0 3.0 28604.7
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 4.29 2277.35 (0.40%) 530.36 2875.45 55.80%
mp5_regen Mana 1803.90 87773.03 (15.28%) 48.66 47519.24 35.12%
sword_of_light Mana 225.05 484393.99 (84.32%) 2152.35 325800.41 40.21%
holy_power_crusader_strike Holy Power 66.32 66.32 (27.82%) 1.00 0.00 0.00%
holy_power_exorcism Holy Power 48.62 48.62 (20.40%) 1.00 0.00 0.00%
holy_power_hammer_of_wrath Holy Power 59.96 59.96 (25.16%) 1.00 0.00 0.00%
holy_power_judgments_of_the_bold Holy Power 63.47 63.47 (26.63%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 1273.43 1276.52
Holy Power 0.53 0.52
Combat End Resource Mean Min Max
Health 411451.00 411451.00 411451.00
Mana 58609.56 54435.00 60000.00
Holy Power 3.19 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 39.6%
guardian_of_ancient_kings-Mana Cap 39.6%

Procs

Count Interval
the_art_of_war 32.9 13.3sec
wasted_art_of_war 2.7 112.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Sagefraise Damage Per Second
Count 999
Mean 89551.02
Minimum 83373.98
Maximum 96857.57
Spread ( max - min ) 13483.59
Range [ ( max - min ) / 2 * 100% ] 7.53%
Standard Deviation 2100.2741
5th Percentile 86238.84
95th Percentile 93295.75
( 95th Percentile - 5th Percentile ) 7056.91
Mean Distribution
Standard Deviation 66.4497
95.00% Confidence Intervall ( 89420.78 - 89681.26 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2113
0.1 Scale Factor Error with Delta=300 37656
0.05 Scale Factor Error with Delta=300 150624
0.01 Scale Factor Error with Delta=300 3765612
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 89551.02
Distribution Chart

Damage

Sample Data
Count 999
Mean 38582058.52
Distribution Chart

DTPS

Sample Data Sagefraise Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Sagefraise Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Sagefraise Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 346.32
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
4 0.00 seal_of_truth
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 1.03 rebuke
8 0.00 seal_of_truth,if=mana.pct>=90|seal.none
9 0.00 seal_of_insight,if=mana.pct<=30
A 1.00 mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
B 1.00 auto_attack
C 15.20 inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
D 4.42 avenging_wrath,if=buff.inquisition.up
E 2.00 guardian_of_ancient_kings,if=buff.avenging_wrath.up
F 4.29 arcane_torrent
G 7.79 execution_sentence,if=buff.inquisition.up
H 36.62 templars_verdict,if=holy_power=5
I 59.98 hammer_of_wrath
J 8.01 wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
K 48.62 exorcism
L 22.04 judgment,if=target.health.pct<=20|buff.avenging_wrath.up
M 66.32 crusader_strike
N 41.43 judgment
O 26.58 templars_verdict,if=holy_power>=3

Sample Sequence

B7FKMNCDEGIKILIHILIHIKIHILIHILIHIKCILMONMOKMNOMNMOKMNOMNMCKGMNOMNMOKMNOMNMOKMNCMNMOKMNOMNMOKMNDFIMHICGIKJILIHILIHIKJIHILIHMCNKMONMNMOKMNOKMNOMNCMGKMNKHMNOMKNKHMNKHKMCNMKOMNOMNMOKMNDIMHIFKICJILGIHIKJIHILIHILIHKMNHMCKNMONMKOMNMONMKOMNMCKGKMNOMNMKHMNOMNOKMKCNMKOMNMKNDEAHIMIHILIFHICJIKIGILHIMIHIKLHIKLHIMLCIMLHIKLHIMLHIKLHIMLHICLKIMGKHILKHIKLHIMLHIKL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 17426 14895 14012
Agility 196 187 80
Stamina 18932 17211 17042
Intellect 207 197 80
Spirit 201 201 80
Health 411451 387357 0
Mana 60000 60000 0
Holy Power 5 5 0
Spell Power 19306 15020 0
Spell Hit 15.16% 15.16% 2579
Spell Crit 13.27% 8.26% 2908
Spell Haste 22.24% 16.42% 6979
ManaReg per Second 300 300 0
Attack Power 38612 30040 0
Melee Hit 7.59% 7.59% 2579
Melee Crit 14.87% 9.87% 2908
Melee Haste 16.42% 16.42% 6979
Swing Speed 28.06% 16.42% 6979
Expertise 7.58% 7.58% 2576
Armor 32265 32265 32265
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.03% 5.03% 0
Tank-Parry 22.08% 19.50% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.73% 21.48% 2165

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Burden of Guilt
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence

Profile

#!./simc

paladin="Sagefraise"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Sagefraise/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/181/64850101-avatar.jpg"
level=90
race=blood_elf
spec=retribution
role=hybrid
position=back
professions=alchemy=600/inscription=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!200112
glyphs=mass_exorcism/templars_verdict/divine_protection/contemplation/fire_from_the_heavens/winged_vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
actions.precombat+=/seal_of_truth
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=rebuke
actions+=/seal_of_truth,if=mana.pct>=90|seal.none
actions+=/seal_of_insight,if=mana.pct<=30
actions+=/mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
actions+=/auto_attack
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
actions+=/avenging_wrath,if=buff.inquisition.up
actions+=/guardian_of_ancient_kings,if=buff.avenging_wrath.up
actions+=/arcane_torrent
actions+=/execution_sentence,if=buff.inquisition.up
actions+=/templars_verdict,if=holy_power=5
actions+=/hammer_of_wrath
actions+=/wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
actions+=/exorcism
actions+=/judgment,if=target.health.pct<=20|buff.avenging_wrath.up
actions+=/crusader_strike
actions+=/judgment
actions+=/templars_verdict,if=holy_power>=3

head=white_tiger_helmet,id=86681,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=soulgrasp_choker,id=85991,reforge=hit_mastery
shoulders=stonetoe_spaulders,id=89345,gems=80str_160haste_60str,enchant=520str_100crit,reforge=crit_haste
back=cloak_of_peacock_feathers,id=85985,enchant=180hit,reforge=crit_haste
chest=white_tiger_battleplate,id=86683,gems=80str_160haste_80str_160haste_120crit,enchant=80all,reforge=crit_hit
wrists=bonded_soul_bracers,id=89817,enchant=180str,reforge=exp_mastery
hands=white_tiger_gauntlets,id=85342,enchant=170str,reforge=exp_haste
waist=waistplate_of_overwhelming_assault,id=86164,gems=80str_160haste_80str_160hit_160str_120haste
legs=white_tiger_legplates,id=85340,gems=160str_60str,enchant=285str_165crit,reforge=exp_haste
feet=impaling_treads,id=86201,gems=320haste_60hit,enchant=175haste
finger1=seal_of_the_bloodseeker,id=90862,reforge=exp_hit
finger2=ring_of_the_golden_stair,id=89069,reforge=exp_haste
trinket1=lei_shens_final_orders,id=86144
trinket2=relic_of_xuen,id=79327
main_hand=starshatter,id=86140,enchant=windsong,reforge=crit_haste

# Gear Summary
# gear_strength=14012
# gear_agility=80
# gear_stamina=17042
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2576
# gear_hit_rating=2579
# gear_crit_rating=2908
# gear_haste_rating=6979
# gear_mastery_rating=2165
# gear_armor=32265
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=starshatter,weapon=sword2h_3.60speed_12055min_18084max,enchant=windsong

Lienus

Lienus : 83257 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
83256.9 83256.9 110.67 / 0.13% 2949 / 3.5% 20.0 5202.1 5202.1 19.85 / 0.38% 521 / 10.0% 1.3 3979.3 3822.7 Mana 0.00% 34.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Lienus/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Xb!000201
Glyphs
  • mind_spike
  • inner_sanctum
  • dark_binding
  • shadow_ravens
  • shadow
  • confession
Professions
  • tailoring: 600
  • enchanting: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:250696|135862|107261|84163|81221|67920|41648|38237&chds=0,501393&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,7F27DC&chm=t++250696++devouring_plague,9482C9,0,0,15|t++135862++shadow_word_pain,9482C9,1,0,15|t++107261++vampiric_touch,9482C9,2,0,15|t++84163++shadow_word_death,9482C9,3,0,15|t++81221++mind_blast,9482C9,4,0,15|t++67920++mind_spike,4A79D3,5,0,15|t++41648++mind_flay,9482C9,6,0,15|t++38237++divine_star,7F27DC,7,0,15&chtt=Lienus Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,10,9,8,8,7,5,5,4,4,4,3,3,2,1,1,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,7F27DC,9482C9,9482C9,9482C9,336600,9482C9,336600&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|divine_star_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|stormlash|touch_of_the_grave|shadowfiend: stormlash&chtt=Lienus Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:lrtvxyzxvvw00145776432yvtqpmooomkjjhheedededeefffffeeddcdcdddbbbaaaaaabbccdeeeeeddccccccccbaZZYXXXXXYZZabcddddddddddddeeddccccccbbbbccdeeeeeeeedccbbaaaaZZZZZaZaaabbcdddddddddddccccccdddefggghhiiijjjjjihgfeecbbaaZZaaaabbbbbccddeeeeeeeeddcbbabbbbbccccccccdccddddddddccbaaZZZZZaabbbcccccccccccccccbbbaaaabbcddeeefffgghhiiiiiihhggffeeefffffgggggggfgfggghghhgggffffefgghijklmmnnnooopoppppoonmmlkjjjiihhhhhhhhhhhhhhhiiiiiiiiijjjkkkllmmmmmmmmmmmmmmmmmmmmlllllllllllllllllllkkllllmmmnnnnnnnnnnnnnoooooonnnnnmmmmmmmmmmmllkllllllllllllllllllllmlllllllkkkkjjjjjjjijii&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5377,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=83257|max=154829&chxp=1,1,54,100&chtt=Lienus DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:5,4,6,10,9,10,8,24,26,22,25,25,31,37,51,51,39,53,53,57,46,51,49,36,40,37,22,22,33,14,26,17,10,11,7,5,9,3,4,4,3,1,0,0,0,1,0,0,0,2&chds=0,57&chbh=5&chxt=x&chxl=0:|min=78939|avg=83257|max=90067&chxp=0,1,39,100&chtt=Lienus DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:42.7,13.5,9.6,8.6,7.6,7.4,5.2,4.5,0.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,7F27DC,9482C9,9482C9,9482C9&chl=mind_flay 192.6s|mind_blast 61.0s|mind_spike 43.3s|vampiric_touch 39.0s|shadow_word_pain 34.3s|divine_star 33.5s|devouring_plague 23.4s|shadow_word_death 20.5s|shadowfiend 3.8s&chtt=Lienus Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Lienus 83257
devouring_plague 5208 (12998) 6.3% (15.6%) 17.7 25.24sec 330826 250696 111623 230193 132524 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.73 17.73 0.00 0.00 1.3197 0.0000 2349284.02 2349284.02 0.00 250696.47 250696.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.60 82.37% 111622.88 92723 154709 111620.45 103349 118709 1629938 1629938 0.00
crit 3.13 17.63% 230193.18 191009 318700 224423.31 0 290611 719346 719346 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<2|target.health.pct<20)
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=6782} Shadow damage and an additional {$s5=1127} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1681 2.0% 34.2 12.55sec 22152 0 18526 38341 22171 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.25 34.22 0.00 0.00 0.0000 0.0000 758662.11 758662.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.93 81.61% 18526.25 15400 25692 18525.27 16960 19881 517419 517419 0.00
crit 6.29 18.39% 38340.85 31724 52925 38152.89 0 45973 241243 241243 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=6782} Shadow damage and an additional {$s5=1127} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6109 7.3% 17.7 25.24sec 155510 0 0 0 0 0.0% 0.0% 0.0% 0.0% 124.5 18505 38230 22144 18.4% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.73 17.73 124.50 124.50 0.0000 0.8260 2756847.03 2756847.03 0.00 26808.45 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.5 81.55% 18505.42 15400 25692 18505.07 17476 19651 1878913 1878913 0.00
crit 23.0 18.45% 38230.11 31724 52925 38235.10 34995 42165 877934 877934 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=6782} Shadow damage and an additional {$s5=1127} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_star 0 (2840) 0.0% (3.4%) 25.5 17.87sec 50244 38237 0 0 0 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_star

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.48 25.48 0.00 0.00 1.3140 0.0000 0.00 0.00 0.00 38236.76 38236.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.75 81.41% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.74 18.59% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: divine_star

Static Values
  • id:122121
  • school:spellshadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13499.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.divine_star.enabled
Spelldata
  • id:122121
  • name:Divine Star
  • school:spellshadow
  • tooltip:Running the target check.
  • description:Fires a Divine Star in front of you, traveling 24 yds, causing {$122128s1=6524 to 8883} Spellshadow damage to all enemies and {$122128s2=10859 to 14784} healing to all allies within 6 yds of its path. After reaching its destination it will return to you, also dealing damage and healing to all targets in its path.
divine_star_damage 2840 3.4% 51.0 17.87sec 25122 0 20977 43434 25120 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_star_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.96 50.96 0.00 0.00 0.0000 0.0000 1280281.30 1280281.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.56 81.54% 20977.29 18918 29516 20979.48 20272 21649 871748 871748 0.00
crit 9.41 18.46% 43433.87 38971 60803 43452.27 39686 48914 408533 408533 0.00
DPS Timeline Chart

Action details: divine_star_damage

Static Values
  • id:122128
  • school:spellshadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:122128
  • name:Divine Star
  • school:spellshadow
  • tooltip:
  • description:{$@spelldesc122121=Fires a Divine Star in front of you, traveling 24 yds, causing {$122128s1=6524 to 8883} Spellshadow damage to all enemies and {$122128s2=10859 to 14784} healing to all allies within 6 yds of its path. After reaching its destination it will return to you, also dealing damage and healing to all targets in its path.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:3537.86
  • base_dd_max:5896.44
divine_star_heal 5202 100.0% 51.0 17.87sec 46063 0 1664 3303 2013 21.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_star_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.96 1166.27 0.00 0.00 0.0000 0.0000 2347514.49 51554153.05 95.45 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 918.03 78.72% 1663.85 0 46785 1662.36 1162 2085 1527453 33067878 95.39
crit 248.24 21.28% 3303.01 0 96376 3296.06 1060 6178 820061 18486275 95.57
HPS Timeline Chart

Action details: divine_star_heal

Static Values
  • id:122128
  • school:spellshadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lienus
  • harmful:true
  • if_expr:
Spelldata
  • id:122128
  • name:Divine Star
  • school:spellshadow
  • tooltip:
  • description:{$@spelldesc122121=Fires a Divine Star in front of you, traveling 24 yds, causing {$122128s1=6524 to 8883} Spellshadow damage to all enemies and {$122128s2=10859 to 14784} healing to all allies within 6 yds of its path. After reaching its destination it will return to you, also dealing damage and healing to all targets in its path.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.757250
  • base_dd_min:5888.01
  • base_dd_max:9813.36
mind_blast 10990 13.2% 46.5 9.78sec 106565 81221 88861 185163 106569 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.48 46.48 0.00 0.00 1.3120 0.0000 4953415.59 4953415.59 0.00 81220.84 81220.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.94 81.62% 88860.99 74108 124460 88867.27 84954 92197 3371066 3371066 0.00
crit 8.55 18.38% 185162.96 152662 256387 185150.06 161100 206814 1582350 1582350 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8999.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=15286 to 15439} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13959 (17807) 16.8% (21.4%) 100.8 4.39sec 79577 41648 0 0 0 0.0% 0.0% 0.0% 0.0% 219.1 23945 49676 28704 18.5% 0.0% 39.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.81 100.81 219.08 219.08 1.9107 0.8091 6288588.91 6288588.91 0.00 41647.88 41647.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.6 81.50% 23945.08 19737 32931 23945.72 23200 24552 4275611 4275611 0.00
crit 40.5 18.50% 49676.38 40659 67839 49680.82 47100 52334 2012978 2012978 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3848 4.6% 61.0 7.12sec 28423 0 23702 49284 28433 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.99 60.97 0.00 0.00 0.0000 0.0000 1733626.17 1733626.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.70 81.51% 23702.42 19737 32931 23705.00 22485 24839 1178032 1178032 0.00
crit 11.27 18.49% 49283.61 40659 67839 49274.36 44452 54829 555594 555594 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6523 7.8% 33.1 13.05sec 88786 67920 74130 153586 88785 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.15 33.15 0.00 0.00 1.3072 0.0000 2942828.98 2942828.98 0.00 67919.80 67919.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.03 81.55% 74130.14 62145 104828 74135.80 69307 79730 2003783 2003783 0.00
crit 6.11 18.45% 153585.56 128019 215946 153634.02 0 192451 939046 939046 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=9863 to 9936} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3806 4.6% 15.3 5.59sec 112331 84163 93777 194001 112349 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.32 15.32 0.00 0.00 1.3347 0.0000 1721394.40 1721394.40 0.00 84163.42 84163.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.49 81.49% 93777.42 71845 121018 93877.18 87755 100949 1171048 1171048 0.00
crit 2.84 18.51% 194001.07 148002 249298 181643.98 0 249298 550346 550346 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=14497} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 8012 (10332) 9.6% (12.4%) 26.1 17.58sec 178589 135862 0 0 0 0.0% 0.0% 0.0% 0.0% 207.7 13322 27616 17391 28.5% 0.0% 99.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.08 26.08 207.73 207.73 1.3145 2.1561 3612569.71 3612569.71 0.00 9660.07 135861.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.6 71.53% 13322.04 11576 19310 13323.66 12597 14623 1979526 1979526 0.00
crit 59.1 28.47% 27615.86 23848 39778 27619.92 25816 30643 1633044 1633044 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|remains<tick_time)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2319 2.8% 57.8 7.69sec 18075 0 13861 28729 18087 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.82 57.78 0.00 0.00 0.0000 0.0000 1045044.32 1045044.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.36 71.58% 13861.36 11576 19310 13865.53 13228 14569 573301 573301 0.00
crit 16.42 28.42% 28729.14 23848 39778 28738.53 26246 31535 471743 471743 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 183.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 1.3107 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3109 3.7% 69.8 6.39sec 20087 0 17199 34652 20442 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.78 68.57 0.00 0.00 0.0000 0.0000 1401664.29 1401664.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.83 81.42% 17199.45 14307 24128 17200.71 16605 18051 960288 960288 0.00
crit 12.74 18.58% 34652.32 28614 48256 34652.76 31357 39278 441376 441376 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
stormlash 1182 1.4% 36.1 9.09sec 14524 0 11835 24778 14526 20.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.14 36.14 0.00 0.00 0.0000 0.0000 524932.82 524932.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.64 79.23% 11835.47 9207 14915 11841.01 10949 12860 338929 338929 0.00
crit 7.51 20.77% 24778.10 18967 30725 24760.85 0 28486 186004 186004 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:10625.40
  • base_dd_max:10625.40
touch_of_the_grave 860 1.0% 20.8 21.90sec 18675 0 18675 0 18675 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.78 20.78 0.00 0.00 0.0000 0.0000 388012.62 388012.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.78 100.00% 18675.23 17237 19822 18674.31 17668 19576 388013 388013 0.00
DPS Timeline Chart

Action details: touch_of_the_grave

Static Values
  • id:5227
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5227
  • name:Touch of the Grave
  • school:physical
  • tooltip:
  • description:Your attacks and damaging spells have a chance to drain the target, dealing {$127802s1=12654 to 14706} Shadow damage and healing you for the same amount.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:13680.00
  • base_dd_max:13680.00
vampiric_touch 7256 (9279) 8.7% (11.2%) 29.6 15.33sec 141244 107261 0 0 0 0.0% 0.0% 0.0% 0.0% 177.9 15383 31819 18393 18.3% 0.0% 97.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.62 29.62 177.90 177.90 1.3169 2.4705 3271950.23 3271950.23 0.00 8742.78 107260.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 145.3 81.69% 15383.41 12822 21827 15385.22 14852 16051 2235802 2235802 0.00
crit 32.6 18.31% 31818.52 26413 44963 31831.94 29802 34241 1036148 1036148 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8999.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2022 2.4% 49.3 8.90sec 18508 0 15516 32171 18519 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.26 49.23 0.00 0.00 0.0000 0.0000 911653.43 911653.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.35 81.97% 15516.32 12822 21827 15520.02 14591 16461 626099 626099 0.00
crit 8.88 18.03% 32170.89 26413 44963 32178.96 27066 38093 285554 285554 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46004 / 3531
melee 45760 4.2% 29.8 12.50sec 52699 49839 45411 93905 52691 20.4% 0.0% 23.6% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.78 29.78 0.00 0.00 1.0574 0.0000 1569418.78 1569418.78 0.00 49838.64 49838.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.69 56.04% 45410.87 32896 54887 45423.80 39790 49899 757928 757928 0.00
crit 6.07 20.37% 93904.79 65793 109774 93833.06 0 109774 569496 569496 0.00
glance 7.03 23.59% 34440.28 24672 41165 34432.92 0 41165 241995 241995 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.77 5.77 0.00 0.00 1.2767 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
stormlash 244 0.0% 10.9 0.93sec 755 0 607 1218 755 24.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 10.94 0.00 0.00 0.0000 0.0000 8258.33 8258.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.30 75.82% 607.19 502 630 607.21 528 630 5037 5037 0.00
crit 2.65 24.18% 1217.54 1004 1260 1160.13 0 1260 3221 3221 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:570.09
  • base_dd_max:570.09

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.13%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
glyph_mind_spike 24.7 8.5 17.7sec 13.1sec 32.63% 51.13%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:26.39%
  • glyph_mind_spike_2:6.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 413.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 11.9 7.5 37.9sec 22.6sec 40.43% 40.29%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:40.43%

    Trigger Attempt Success

    • trigger_pct:2.28%
lightweave_embroidery_3 8.0 0.0 59.4sec 59.4sec 26.32% 26.32%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:57.00
  • default_chance:25.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.32%

    Trigger Attempt Success

    • trigger_pct:23.94%
relic_of_yulon 9.0 0.0 52.7sec 52.7sec 29.33% 29.33%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.33%

    Trigger Attempt Success

    • trigger_pct:19.83%
shadow_word_death_reset_cooldown 7.8 0.0 11.6sec 11.6sec 9.95% 49.32%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.95%

Trigger Attempt Success

  • trigger_pct:100.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_darkness 29.3 4.6 14.9sec 12.8sec 19.14% 100.00%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.44%
  • surge_of_darkness_2:1.70%

Trigger Attempt Success

  • trigger_pct:14.92%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 20.4 151.0 17.4sec 2.5sec 62.30% 100.00%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:62.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vision_of_the_predator 4.6 0.0 108.5sec 108.5sec 29.84% 29.84%

Buff details

  • buff initial source:Lienus
  • cooldown name:buff_vision_of_the_predator
  • max_stacks:1
  • duration:30.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3386.00

    Stack Uptimes

    • vision_of_the_predator_1:29.84%

    Trigger Attempt Success

    • trigger_pct:16.62%
shadowfiend-shadowcrawl 5.8 0.0 74.8sec 74.8sec 83.38% 84.04%

Buff details

  • buff initial source:Lienus_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stormlash 2.0 0.0 11.0sec 11.0sec 29.84% 29.84%

Buff details

  • buff initial source:Lienus_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:29.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Lienus
devouring_plague Shadow Orb 17.7 53.2 3.0 3.0 110273.6
divine_star Mana 25.5 343968.0 13499.0 13498.7 3.7
mind_blast Mana 46.5 418291.5 8999.0 8998.9 11.8
mind_flay Mana 100.8 302439.0 3000.0 3000.1 26.5
shadow_word_death Mana 15.3 119542.8 7800.0 7800.9 14.4
shadow_word_pain Mana 26.1 344256.0 13200.0 13200.0 13.5
vampiric_touch Mana 29.6 266550.4 8999.0 8999.1 15.7
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 29.78 121551.74 (7.05%) 4081.38 146486.26 54.65%
Shadow Orbs from Mind Blast Shadow Orb 46.48 46.48 (85.68%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.77 7.77 (14.32%) 1.00 0.00 0.00%
Devouring Plague Health Health 158.73 0.00 (-nan%) 0.00 1925106.70 100.00%
Vampiric Touch Mana Mana 227.13 1104970.16 (64.08%) 4864.95 110125.84 9.06%
mp5_regen Mana 1803.90 497914.86 (28.87%) 276.02 43254.24 7.99%
touch_of_the_grave Health 20.77 0.00 (-nan%) 0.00 387977.96 100.00%
Resource RPS-Gain RPS-Loss
Mana 3822.74 3979.27
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 404283.00 404283.00 404283.00
Mana 229380.21 140125.00 300000.00
Shadow Orb 1.07 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.1%
shadowfiend-Mana Cap 8.1%
lightwell-Mana Cap 8.1%

Procs

Count Interval
Shadowy Recall Extra Tick 202.2 2.2sec
Shadowy Apparition Procced 69.8 6.4sec
FDCL Mind Spike proc 33.9 12.8sec
touch_of_the_grave 20.8 21.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Lienus Damage Per Second
Count 999
Mean 83256.87
Minimum 78938.74
Maximum 90067.22
Spread ( max - min ) 11128.49
Range [ ( max - min ) / 2 * 100% ] 6.68%
Standard Deviation 1784.6706
5th Percentile 80370.41
95th Percentile 86269.16
( 95th Percentile - 5th Percentile ) 5898.75
Mean Distribution
Standard Deviation 56.4645
95.00% Confidence Intervall ( 83146.20 - 83367.54 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1765
0.1 Scale Factor Error with Delta=300 27189
0.05 Scale Factor Error with Delta=300 108757
0.01 Scale Factor Error with Delta=300 2718941
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 83256.87
Distribution Chart

Damage

Sample Data
Count 999
Mean 35940755.93
Distribution Chart

DTPS

Sample Data Lienus Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Lienus Healing Per Second
Count 999
Mean 5202.10
Minimum 4131.19
Maximum 6296.54
Spread ( max - min ) 2165.36
Range [ ( max - min ) / 2 * 100% ] 20.81%
Standard Deviation 320.0354
5th Percentile 4700.13
95th Percentile 5742.11
( 95th Percentile - 5th Percentile ) 1041.98
Mean Distribution
Standard Deviation 10.1255
95.00% Confidence Intervall ( 5182.25 - 5221.94 )
Normalized 95.00% Confidence Intervall ( 99.62% - 100.38% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 145
0.1% Error 14539
0.1 Scale Factor Error with Delta=300 874
0.05 Scale Factor Error with Delta=300 3497
0.01 Scale Factor Error with Delta=300 87433
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 5202.10
Distribution Chart

Heal

Sample Data
Count 999
Mean 2347514.49
Distribution Chart

HTPS

Sample Data Lienus Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 259.55
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 5.48 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<2|target.health.pct<20)
A 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
B 46.57 mind_blast,if=active_enemies<=6&cooldown_react
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 26.08 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|remains<tick_time)
E 15.33 shadow_word_death,if=active_enemies<=5
F 29.69 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
G 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
H 12.24 devouring_plague,if=shadow_orb=3
I 0.00 halo,if=talent.halo.enabled
J 33.14 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react
K 0.00 cascade_damage,if=talent.cascade.enabled
L 25.48 divine_star,if=talent.divine_star.enabled
M 0.00 mindbender,if=talent.mindbender.enabled
N 2.91 shadowfiend,if=!talent.mindbender.enabled
O 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
P 61.62 mind_flay,chain=1,interrupt=1
Q 0.00 shadow_word_death,moving=1
R 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
S 0.00 shadow_word_pain,moving=1
T 0.00 dispersion

Sample Sequence

BDFLNPBPDFBHLPBJJFPDPLBPBFHPDJJBLPFPBPDPLBFHJJPBDPLFPBPJPBDFHLPBPDFBLPBHFJDPLBPFBPDPLPBHJFPBDLPBFNPDBHLJFPBPJDLBFPBHPLDFPBPJPJBFDLJPBHPJPFBJDLPBPFJPBDHLPBFPBDLPFPBHJPDLBFPJPBPDFJBHLPBFDJJPLBPFJBHDJEELBNPFE9BDEPLPJBE9EFPBDEELP8FB9EEJDPBJE9EFJBJLPDEB9EFJJPBE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 133 127 80
Agility 311 296 240
Stamina 18420 16745 16668
Intellect 17805 15592 14645
Spirit 3348 3348 3127
Health 404283 380833 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 29231 22146 6564
Spell Hit 15.01% 15.01% 1977
Spell Crit 18.59% 12.72% 3195
Spell Haste 18.95% 13.29% 5647
ManaReg per Second 1200 1200 0
Attack Power 135 117 0
Melee Hit 15.01% 15.01% 1977
Melee Crit 13.90% 8.88% 3195
Melee Haste 13.29% 13.29% 5647
Swing Speed 24.62% 13.29% 5647
Expertise 0.00% 0.00% 0
Armor 22225 13891 13891
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 27.67% 18.67% 1420

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Lienus"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Lienus/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/30/70926878-avatar.jpg"
level=90
race=undead
spec=shadow
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!000201
glyphs=mind_spike/inner_sanctum/dark_binding/shadow_ravens/shadow/confession

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=shadowform
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<2|target.health.pct<20)
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|remains<tick_time)
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/devouring_plague,if=shadow_orb=3
actions+=/halo,if=talent.halo.enabled
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=yalias_cowl,id=89338,gems=burning_primal_80int_160spi_180int
neck=amulet_of_seven_curses,id=85986,reforge=hit_haste
shoulders=mantle_of_the_golden_sun,id=89340,gems=80int_160haste_60int,enchant=200int_100crit,reforge=hit_haste
back=stormwake_mistcloak,id=86182,enchant=lightweave_embroidery_3,reforge=crit_haste
chest=spelltwisters_grand_robe,id=82437,gems=80int_160haste_80int_160spi_120int,enchant=80all,reforge=mastery_crit
shirt=brown_linen_shirt,id=4344
wrists=bracers_of_inlaid_jade,id=88892,enchant=180int,reforge=spi_haste
hands=guardian_serpent_gloves,id=85364,enchant=170haste,reforge=spi_crit
waist=klaxxi_lash_of_the_seeker,id=89063,gems=80int_160spi_160int_60spi
legs=guardian_serpent_leggings,id=86706,gems=160int_60int,enchant=285int_165crit,reforge=mastery_crit
feet=sandals_of_the_unbidden,id=86178,gems=80int_160haste_60hit,enchant=140mastery,reforge=mastery_haste
finger1=seal_of_the_lucid,id=90859,enchant=160agi,reforge=mastery_haste
finger2=circuit_of_the_frail_soul,id=86038,enchant=160int,reforge=spi_haste
trinket1=vision_of_the_predator,id=81192
trinket2=relic_of_yulon,id=79331
main_hand=torch_of_the_celestial_spark,id=86137,enchant=jade_spirit,reforge=crit_spi
off_hand=fan_of_fiery_winds,id=89426,enchant=165int,reforge=spi_crit

# Gear Summary
# gear_strength=80
# gear_agility=240
# gear_stamina=16668
# gear_intellect=14645
# gear_spirit=3127
# gear_spell_power=6564
# gear_hit_rating=1977
# gear_crit_rating=3195
# gear_haste_rating=5647
# gear_mastery_rating=1420
# gear_armor=13891
# meta_gem=burning_primal
# tier14_2pc_caster=1
# back=stormwake_mistcloak,enchant=lightweave_embroidery_3
# main_hand=torch_of_the_celestial_spark,enchant=jade_spirit

Brwazou

Brwazou : 65957 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
65957.4 65957.4 138.22 / 0.21% 3618 / 5.5% 24.1 2487.2 2458.6 Mana 0.00% 39.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Brwazou/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Wa!110222
Glyphs
  • flame_shock
  • chain_lightning
  • unleashed_lightning
  • astral_recall
  • lakestrider
  • spectral_wolf
Professions
  • jewelcrafting: 600
  • enchanting: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:107713|78635|78166|67377|34048&chds=0,215427&chco=C41F3B,336600,C41F3B,62480C,336600&chm=t++107713++lava_burst,C41F3B,0,0,15|t++78635++earth_shock,336600,1,0,15|t++78166++flame_shock,C41F3B,2,0,15|t++67377++elemental_blast,62480C,3,0,15|t++34048++lightning_bolt,336600,4,0,15&chtt=Brwazou Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,21,9,9,6,6,6,5,3,3,3,2,2,1,1,1,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,336600,C41F3B,62480C,336600,C41F3B,C41F3B,336600,336600,C41F3B,62480C,C41F3B,336600,336600,C79C6E,C41F3B,62480C,C41F3B,336600,62480C,336600,C41F3B&chl=lava_burst|lightning_bolt|lava_burst_overload|elemental_blast|lightning_bolt_overload|flame_shock|greater_fire_elemental: fire_melee|fulmination|stormlash|searing_totem: searing_bolt|elemental_blast_overload|lava_burst_eoe|earth_shock|lightning_bolt_eoe|greater_earth_elemental: earth_melee|lava_burst_overload_eoe|elemental_blast_eoe|greater_fire_elemental: fire_blast|lightning_bolt_overload_eoe|elemental_blast_overload_eoe|earth_shock_eoe|flame_shock_eoe&chtt=Brwazou Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:suxyxyz012235777642zxvsqopnljhedddccbaaaabbbaaZZYYXWWVVVUUTTTSSSRRRRRRRSSTTTTTTTTTTTTTTTTTTTSTSSSSTTTTUUUUUUUUUUTTTTTTTTTSSSSSSSSSSSSTTTTTTTTTTTTTTTTTSSSSSSSSRSSSSSTTTTTTTSSSSSTTUVWXYZabcddefghhhhhhgffecbaZYXWVUTTSSSRSRSRRSSSTTTTTTTTTTTTTTTTTTTTTTSSSSSSSSSTTTSSSSSSSSSSSSSSSRRRRRRRRRSSSSSSSSSSSSSTUUVVWXXYZZZabbcdefgggggffeeddccbbaaZYYXWWVVVWWWWWWWWWWWWWWVVUUUUUUVVWXYYZabcdefghiiiiiihggfecbaZYXWVVUUTTTTSSSTTTTTTTTTTTTTSSSSSSSSSSRRRRRRRRRRSSSSSTTTTTTTTTTTTTTTTSSSSSSSSSSSSTTTTTTSSSSSSSSSRRRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSSRRRRRRRRRRRRRRRRRRRQQPPQPPPPPPOOOO&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3907,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=65957|max=168836&chxp=1,1,39,100&chtt=Brwazou DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,4,2,3,4,6,9,11,4,23,17,20,26,28,32,37,53,29,48,39,37,50,42,45,39,39,44,41,42,31,30,27,16,19,18,13,12,19,8,3,5,4,4,3,2,2,3,1,3&chds=0,53&chbh=5&chxt=x&chxl=0:|min=59872|avg=65957|max=72750&chxp=0,1,47,100&chtt=Brwazou DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:51.1,23.7,10.8,5.5,4.5,1.4,0.5,0.5&chds=0,100&chdls=ffffff&chco=336600,C41F3B,62480C,336600,C41F3B,C41F3B,C41F3B,336600&chl=lightning_bolt 230.5s|lava_burst 106.7s|elemental_blast 48.6s|earth_shock 24.7s|flame_shock 20.2s|searing_totem 6.3s|fire_elemental_totem 2.1s|earth_elemental_totem 2.1s&chtt=Brwazou Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Brwazou 65957
ascendance 0 0.0% 2.9 184.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|buff.berserking.up)&cooldown.lava_burst.remains>0
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for {$114051d=15 seconds}. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
berserking 0 0.0% 2.9 184.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up&!buff.elemental_mastery.up&buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
earth_elemental_totem 0 0.0% 1.9 302.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 1.0734 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:nature
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active&cooldown.fire_elemental_totem.remains>=50
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:nature
  • tooltip:
  • description:Summons an Earth Totem with {$s1=154755} health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts {$d=60 seconds}.
earth_shock 995 (4304) 1.5% (6.5%) 18.6 22.80sec 104196 78635 18697 48435 24081 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.64 18.64 0.00 0.00 1.3251 0.0000 448942.49 448942.49 0.00 78634.91 78634.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.27 81.90% 18696.52 17729 22985 18703.09 17926 19652 285469 285469 0.00
crit 3.38 18.10% 48434.70 45919 59532 47049.27 0 59532 163473 163473 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s2=5028 to 5242} Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by {$115798s1=10}% for {$115798d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 58 0.1% 1.1 135.53sec 23639 0 18086 46921 23624 19.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.11 1.11 0.00 0.00 0.0000 0.0000 26170.44 26170.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.89 80.74% 18086.11 17729 22985 10651.52 0 22985 16166 16166 0.00
crit 0.21 19.26% 46920.55 45919 59532 9110.56 0 59532 10004 10004 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s2=5028 to 5242} Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by {$115798s1=10}% for {$115798d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
elemental_blast 5232 (7251) 8.0% (11.0%) 27.5 15.92sec 118796 67377 66396 171990 85901 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.54 27.48 0.00 0.00 1.7632 0.0000 2360986.48 2360986.48 0.00 67376.71 67376.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.41 81.52% 66395.54 61008 79771 66418.66 64495 68985 1487601 1487601 0.00
crit 5.08 18.48% 171989.68 158012 206607 170829.37 0 206607 873386 873386 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=15252 to 15961} Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by {$118522s1=3500} for {$118522d=8 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_eoe 298 0.5% 1.6 119.26sec 84207 0 66160 171103 84186 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.60 1.60 0.00 0.00 0.0000 0.0000 134781.85 134781.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.33 82.80% 66159.94 61008 79771 48193.70 0 79771 87682 87682 0.00
crit 0.28 17.20% 171102.53 158012 206607 41159.82 0 206607 47100 47100 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=15252 to 15961} Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by {$118522s1=3500} for {$118522d=8 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_overload 1632 2.5% 11.4 36.47sec 64530 0 49757 129065 64710 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.40 11.37 0.00 0.00 0.0000 0.0000 735478.86 735478.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.23 81.16% 49756.63 45757 59828 49761.88 46519 53498 459007 459007 0.00
crit 2.14 18.84% 129065.03 118510 154956 113178.97 0 154956 276472 276472 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=11439 to 11971} Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
elemental_blast_overload_eoe 89 0.1% 0.6 140.60sec 64813 0 49774 128541 64789 19.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.62 0.62 0.00 0.00 0.0000 0.0000 40094.27 40094.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.50 80.91% 49773.72 45757 59828 19893.88 0 59828 24911 24911 0.00
crit 0.12 19.09% 128541.30 118510 154956 14672.96 0 154956 15183 15183 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=11439 to 11971} Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
fire_elemental_totem 0 0.0% 2.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0730 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=154755} health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts {$d=60 seconds}.
flame_shock 3479 (3505) 5.3% (5.3%) 15.1 30.78sec 104542 78166 10433 27035 13320 17.4% 0.0% 0.0% 0.0% 177.6 6010 15558 7696 17.7% 0.0% 98.9%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.11 15.11 177.59 177.59 1.3374 2.5127 1568035.87 1568035.87 0.00 3386.76 78166.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.49 82.64% 10433.38 9796 12795 10435.98 9796 10965 130297 130297 0.00
crit 2.62 17.36% 27035.48 25372 33138 25310.55 0 33138 70908 70908 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.2 82.34% 6009.94 5865 7010 6012.31 5915 6082 878803 878803 0.00
crit 31.4 17.66% 15558.43 15191 18155 15563.94 15191 16207 488029 488029 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every {$t2=3} sec.
  • description:Instantly sears the target with fire, causing {$s1=3399} Fire damage immediately and $o2 Fire damage over {$d=24 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 26 0.0% 0.9 152.57sec 12612 0 10049 26206 12626 15.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.93 0.93 0.00 0.00 0.0000 0.0000 11703.00 11703.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.78 84.14% 10048.89 9796 12795 5648.66 0 12795 7846 7846 0.00
crit 0.15 15.86% 26206.34 25372 33138 3620.91 0 30126 3857 3857 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every {$t2=3} sec.
  • description:Instantly sears the target with fire, causing {$s1=3399} Fire damage immediately and $o2 Fire damage over {$d=24 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 3251 4.9% 18.6 22.80sec 78712 0 60981 158591 78714 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.64 18.64 0.00 0.00 0.0000 0.0000 1467483.82 1467483.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.26 81.84% 60981.05 32822 86164 61062.55 51902 69436 930411 930411 0.00
crit 3.39 18.16% 158591.13 85008 223165 153639.73 0 223165 537073 537073 0.00
DPS Timeline Chart

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:Discharges lightning at an attacker, dealing {$s1=2629} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.388000
  • base_dd_min:629.69
  • base_dd_max:629.69
lava_burst 18842 (25564) 28.5% (38.7%) 87.1 5.15sec 131983 107713 0 97431 97431 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.09 86.95 0.00 0.00 1.2253 0.0000 8471467.98 8471467.98 0.00 107713.44 107713.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 86.95 100.00% 97430.77 87482 114863 97482.36 95695 99230 8471468 8471468 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4619.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=7840 to 8314} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_eoe 1127 1.7% 5.3 70.74sec 96138 0 35993 96411 96273 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.27 5.27 0.00 0.00 0.0000 0.0000 506962.86 506962.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.23% 35992.59 33777 40317 432.34 0 40317 432 432 0.00
crit 5.25 99.77% 96410.67 87482 114863 95893.50 0 114863 506531 506531 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4619.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=7840 to 8314} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_overload 5271 8.0% 33.1 13.43sec 71681 0 0 71882 71882 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.06 32.97 0.00 0.00 0.0000 0.0000 2369977.31 2369977.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 32.97 100.00% 71882.21 65610 86146 71918.99 68991 75704 2369977 2369977 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=5880 to 6235} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lava_burst_overload_eoe 324 0.5% 2.0 116.08sec 74567 0 27865 74904 74759 99.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 0.0000 0.0000 145477.44 145477.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.31% 27865.45 27865 27865 167.36 0 27865 167 167 0.00
crit 1.94 99.69% 74904.42 72172 86146 65290.64 0 86146 145310 145310 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=5880 to 6235} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lightning_bolt 12767 (17396) 19.4% (26.4%) 131.4 3.27sec 59724 34048 34126 88425 43918 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.39 131.16 0.00 0.00 1.7541 0.0000 5760085.56 5760085.56 0.00 34048.19 34048.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.51 81.97% 34125.78 31376 41160 34134.90 33687 34792 3668719 3668719 0.00
crit 23.65 18.03% 88424.70 81265 106604 88407.07 85522 91919 2091366 2091366 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4259.0
  • cooldown:0.00
  • base_execute_time:2.10
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=4993 to 5162} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.739000
  • base_dd_min:1186.04
  • base_dd_max:1355.02
lightning_bolt_eoe 752 1.1% 7.9 47.68sec 42996 0 33105 85822 43056 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.88 7.87 0.00 0.00 0.0000 0.0000 338715.40 338715.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.38 81.11% 33105.47 31376 41160 33122.42 31376 37837 211224 211224 0.00
crit 1.49 18.89% 85821.92 81265 106604 65857.17 0 106604 127492 127492 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4259.0
  • cooldown:0.00
  • base_execute_time:2.10
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=4993 to 5162} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.739000
  • base_dd_min:1186.04
  • base_dd_max:1355.02
lightning_bolt_overload 3655 5.6% 51.4 8.31sec 32085 0 24940 64652 32181 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.36 51.20 0.00 0.00 0.0000 0.0000 1647911.13 1647911.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.86 81.76% 24939.79 23522 30856 24945.98 24246 25756 1043974 1043974 0.00
crit 9.34 18.24% 64652.04 60922 79918 64664.49 60922 71315 603937 603937 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=3744 to 3870} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.554000
  • base_dd_min:889.53
  • base_dd_max:1016.27
lightning_bolt_overload_eoe 222 0.3% 3.1 89.69sec 32228 0 24883 64475 32301 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.11 3.10 0.00 0.00 0.0000 0.0000 100168.97 100168.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.52 81.24% 24882.96 23522 30856 22716.33 0 30856 62671 62671 0.00
crit 0.58 18.76% 64475.37 60922 79918 28366.44 0 79918 37498 37498 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=3744 to 3870} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.554000
  • base_dd_min:889.53
  • base_dd_max:1016.27
searing_totem 0 0.0% 5.9 72.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 5.90 0.00 0.00 1.0739 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.fire_elemental_totem.remains>15&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=5} health at your feet for {$d=60 seconds} that repeatedly attacks an enemy within $3606r1 yards for {$3606s1=626 to 647} Fire damage.
stormlash 2068 3.1% 40.9 8.01sec 22426 0 18504 37870 22425 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.91 40.91 0.00 0.00 0.0000 0.0000 917367.74 917367.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.62 79.75% 18503.53 7912 31823 18546.12 15156 22578 603653 603653 0.00
crit 8.28 20.25% 37869.95 16298 65556 37972.06 19668 56815 313714 313714 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8497.50
  • base_dd_max:8497.50
pet - greater_fire_elemental 13417 / 3623
fire_blast 973 0.4% 20.0 18.77sec 5839 0 4548 11372 5839 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 19.98 0.00 0.00 0.0000 0.0000 116661.34 116661.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.20 81.08% 4548.43 4242 5116 4548.48 4339 4752 73676 73676 0.00
crit 3.78 18.92% 11372.22 10606 12790 11219.17 0 12790 42985 42985 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 12443 5.0% 103.1 3.49sec 14469 14390 11774 29455 14470 19.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.11 103.11 0.00 0.00 1.0055 0.0000 1491836.64 1491836.64 0.00 14390.24 14390.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.57 56.80% 11774.10 11030 13067 11774.36 11510 12109 689577 689577 0.00
crit 19.83 19.23% 29454.63 27576 32668 29455.47 27576 31279 584001 584001 0.00
glance 24.71 23.97% 8831.87 8273 9800 8831.23 8436 9269 218259 218259 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 2636 / 621
earth_melee 2636 1.0% 62.1 5.34sec 4538 2844 4102 8205 4537 16.7% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.14 62.14 0.00 0.00 1.5957 0.0000 281962.71 281962.71 0.00 2843.68 2843.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.73 59.10% 4102.40 4102 4102 4102.40 4102 4102 150663 150663 0.00
crit 10.36 16.67% 8204.79 8205 8205 8204.79 8205 8205 84972 84972 0.00
glance 15.06 24.23% 3076.80 3077 3077 3076.80 3077 3077 46328 46328 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 2448 / 1624
searing_bolt 2448 2.5% 185.5 2.06sec 3979 0 3163 7919 3998 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.48 184.58 0.00 0.00 0.0000 0.0000 737997.54 737997.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.17 82.44% 3163.05 2991 3949 3162.93 3116 3203 481326 481326 0.00
crit 32.41 17.56% 7919.01 7477 9874 7918.70 7715 8123 256672 256672 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.9 0.0 184.0sec 184.0sec 9.60% 9.60%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ascendance_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
berserking 2.9 0.0 184.3sec 184.3sec 6.46% 8.90%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by {$s1=20}%.
  • description:Increases your melee, ranged, and spell haste by {$s1=20}% for {$d=10 seconds}.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.42%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
elemental_blast_crit 9.7 0.0 41.8sec 41.8sec 16.22% 16.22%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_elemental_blast_crit
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_crit_1:16.22%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_haste 9.7 0.0 41.7sec 41.7sec 16.12% 16.12%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_haste_1:16.12%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_mastery 9.8 0.0 41.4sec 41.4sec 16.34% 16.34%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_mastery_1:16.34%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_focus 61.4 62.9 7.3sec 3.6sec 60.05% 60.42%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_focus_1:32.73%
  • elemental_focus_2:27.32%

Trigger Attempt Success

  • trigger_pct:99.38%

Spelldata details

  • id:16246
  • name:Clearcasting
  • tooltip:Your next $n spells have their mana cost reduced by {$s1=25}%. Spell damage increased by {$s2=10}%. Single-target healing done increased by {$s4=50}%.
  • description:After landing a critical strike with a Fire, Frost, or Nature damage spell, you enter a Clearcasting state. The Clearcasting state reduces the mana cost of your next $16246n spells by {$16246s1=25}%, increases your spell damage by {$s2=10}%, and increases single-target healing done by {$s4=50}%.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
jade_serpent_potion 1.0 0.0 302.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
vision_of_the_predator 4.5 0.0 110.3sec 110.3sec 29.51% 29.51%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_vision_of_the_predator
  • max_stacks:1
  • duration:30.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3386.00

    Stack Uptimes

    • vision_of_the_predator_1:29.51%

    Trigger Attempt Success

    • trigger_pct:17.39%
windsong_crit 5.6 0.9 71.6sec 59.6sec 15.91% 15.52%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:15.91%

    Trigger Attempt Success

    • trigger_pct:4.29%
windsong_haste 5.5 1.0 71.0sec 58.4sec 15.88% 15.86%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:15.88%

    Trigger Attempt Success

    • trigger_pct:4.27%
windsong_mastery 5.6 1.0 70.5sec 58.6sec 16.14% 15.72%

Buff details

  • buff initial source:Brwazou
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:16.14%

    Trigger Attempt Success

    • trigger_pct:4.32%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Brwazou
ascendance Mana 2.9 9091.7 3120.0 3120.1 0.0
bloodlust Mana 0.0 12.9 12899.0 12886.1 0.0
earth_elemental_totem Mana 1.9 32843.3 16860.0 16860.5 0.0
earth_shock Mana 18.6 143795.5 7712.7 7712.8 13.5
fire_elemental_totem Mana 2.0 32278.0 16139.0 16139.0 0.0
flame_shock Mana 15.1 97154.0 6429.4 6429.3 16.3
lava_burst Mana 87.1 331915.6 3811.4 3811.4 34.6
lightning_bolt Mana 131.4 453861.4 3454.4 3454.4 17.3
searing_totem Mana 5.9 20878.9 3540.0 3540.1 0.0
wind_shear Mana 0.0 141.0 5035.7 5030.7 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.90 602291.61 (54.31%) 333.88 74169.77 10.96%
rolling_thunder Mana 111.36 506770.69 (45.69%) 4550.70 161395.31 24.15%
Resource RPS-Gain RPS-Loss
Mana 2458.58 2487.19
Combat End Resource Mean Min Max
Health 391977.00 391977.00 391977.00
Mana 287083.96 241168.25 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.9%
spirit_wolf-Mana Cap 10.9%
primal_fire_elemental-Mana Cap 10.9%
primal_earth_elemental-Mana Cap 10.9%
earth_elemental_totem-Mana Cap 10.9%
magma_totem-Mana Cap 10.9%
stormlash_totem-Mana Cap 10.9%

Procs

Count Interval
lava_surge 35.5 12.3sec
lightning_shield_too_fast_fill 0.0 nansec
rolling_thunder 111.4 3.8sec
wasted_lightning_shield 7.4 49.2sec
wasted_lightning_shield_shock_cd 0.0 nansec
fulmination_3 1.8 117.8sec
fulmination_4 1.8 120.5sec
fulmination_5 1.6 120.7sec
fulmination_6 13.5 31.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Brwazou Damage Per Second
Count 999
Mean 65957.38
Minimum 59872.18
Maximum 72750.40
Spread ( max - min ) 12878.22
Range [ ( max - min ) / 2 * 100% ] 9.76%
Standard Deviation 2228.9551
5th Percentile 62504.04
95th Percentile 69739.44
( 95th Percentile - 5th Percentile ) 7235.40
Mean Distribution
Standard Deviation 70.5210
95.00% Confidence Intervall ( 65819.16 - 66095.60 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4387
0.1 Scale Factor Error with Delta=300 42411
0.05 Scale Factor Error with Delta=300 169647
0.01 Scale Factor Error with Delta=300 4241176
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 65957.38
Distribution Chart

Damage

Sample Data
Count 999
Mean 27051811.48
Distribution Chart

DTPS

Sample Data Brwazou Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Brwazou Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Brwazou Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 297.30
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 flametongue_weapon,weapon=main
3 0.00 lightning_shield,if=!buff.lightning_shield.up
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.03 wind_shear
7 0.00 bloodlust,if=target.health.pct<25|time>5
8 0.00 stormlash_totem,if=!active&!buff.stormlash.up&(buff.bloodlust.up|time>=60)
9 1.00 jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
A 0.00 run_action_list,name=single,if=active_enemies=1
B 0.00 run_action_list,name=ae,if=active_enemies>1
actions.single
# count action,conditions
C 2.92 berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)
D 0.00 elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
E 2.00 fire_elemental_totem,if=!active
F 2.91 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|buff.berserking.up)&cooldown.lava_burst.remains>0
G 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
H 0.00 unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
I 87.30 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
J 15.11 flame_shock,if=ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
K 27.64 elemental_blast,if=talent.elemental_blast.enabled
L 13.18 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
M 5.46 earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
N 1.95 earth_elemental_totem,if=!active&cooldown.fire_elemental_totem.remains>=50
O 5.90 searing_totem,if=cooldown.fire_elemental_totem.remains>15&!totem.fire.active
P 0.00 spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))|(buff.raid_movement.duration>=action.unleash_elements.gcd+action.earth_shock.gcd)
Q 131.90 lightning_bolt

Sample Sequence

EJCIFIIIIIIIIIIIIIIKQQQQQIJQQKQQIQLIQQQQKIQQMQQQJIKNOQQQILQKQQIMQIQJIKQQQQIQQKQQIQMQQIJKQOQQIQQQKQIQQMQQJIKQQQIQQLQKIQQMQQIJCFIIIIIIIIIIIIIKOIQQQQJIKQLQQIQQKQQIQQLQQJIKQQQQIQQKLOQIQQQJKIQLQQQIQIKIQQE9ILQQJKIQQIQQQLKIQQQQIQLKQQJIQQIQKILIQOQQNQIKQJCFIIIIIIIIIIIIIKQQQMIQQJKQIQQIQLQKOQIQQMQQJIKQQQQIQQK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 234 223 80
Agility 185 176 80
Stamina 17541 15946 15785
Intellect 16198 14062 13246
Spirit 5872 5872 5702
Health 391977 369647 0
Mana 300000 300000 0
Spell Power 23474 19204 5152
Spell Hit 20.11% 20.11% 1134
Spell Crit 17.71% 11.87% 2470
Spell Haste 15.71% 10.20% 4333
ManaReg per Second 1500 1500 0
Attack Power 796 695 0
Melee Hit 20.11% 20.11% 1134
Melee Crit 12.18% 7.18% 2470
Melee Haste 10.20% 10.20% 4333
Swing Speed 21.21% 10.20% 4333
Expertise 0.00% 0.00% 0
Armor 40469 40469 40469
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 36.00% 26.00% 3001

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Brwazou"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Brwazou/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/132/35884164-avatar.jpg"
level=90
race=troll
spec=elemental
role=spell
position=back
professions=jewelcrafting=600/enchanting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!110222
glyphs=flame_shock/chain_lightning/unleashed_lightning/astral_recall/lakestrider/spectral_wolf

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/flametongue_weapon,weapon=main
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/stormlash_totem,if=!active&!buff.stormlash.up&(buff.bloodlust.up|time>=60)
actions+=/jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=active_enemies=1
actions+=/run_action_list,name=ae,if=active_enemies>1

actions.single=berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
actions.single+=/fire_elemental_totem,if=!active
actions.single+=/ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|buff.berserking.up)&cooldown.lava_burst.remains>0
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/flame_shock,if=ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
actions.single+=/earth_elemental_totem,if=!active&cooldown.fire_elemental_totem.remains>=50
actions.single+=/searing_totem,if=cooldown.fire_elemental_totem.remains>15&!totem.fire.active
actions.single+=/spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))|(buff.raid_movement.duration>=action.unleash_elements.gcd+action.earth_shock.gcd)
actions.single+=/lightning_bolt

actions.ae=ascendance
actions.ae+=/lava_beam
actions.ae+=/magma_totem,if=active_enemies>2&!totem.fire.active
actions.ae+=/searing_totem,if=active_enemies<=2&!totem.fire.active
actions.ae+=/lava_burst,if=active_enemies<3&dot.flame_shock.remains>cast_time&cooldown_react
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking&active_enemies<3
actions.ae+=/earthquake,if=active_enemies>4
actions.ae+=/thunderstorm,if=mana.pct_nonproc<80
actions.ae+=/chain_lightning,if=mana.pct_nonproc>10
actions.ae+=/lightning_bolt

head=sixteenfanged_crown,id=86745,gems=revitalizing_primal_320spi_180int,reforge=spi_mastery
neck=amulet_of_seven_curses,id=85986,reforge=hit_haste
shoulders=shoulders_of_empyreal_focus,id=86800,gems=320int_60int,enchant=200int_100crit,reforge=haste_crit
back=stormwake_mistcloak,id=86182
chest=uncasked_chestguard,id=81081,gems=480haste_60int,enchant=80all,reforge=spi_mastery
wrists=luminescent_firefly_wristguards,id=86184,reforge=crit_haste
hands=ravenmanes_gloves,id=88748,enchant=170mastery
waist=chain_of_shadow,id=86755,gems=160haste_160spi_320spi_320spi_120spi
legs=leggings_of_imprisoned_will,id=86040,gems=80int_160spi_320spi_120int,enchant=285int_165spi,reforge=mastery_crit
feet=mengs_treads_of_insanity,id=86084,gems=320spi,enchant=140mastery,reforge=mastery_spi
finger1=the_horsemans_ring,id=88169,enchant=160int,reforge=hit_mastery
finger2=seal_of_the_lucid,id=90859,reforge=hit_haste
trinket1=vision_of_the_predator,id=81192
trinket2=spirits_of_the_sun,id=86885
main_hand=carapace_breaker,id=81094,enchant=windsong,reforge=haste_crit
off_hand=eye_of_the_ancient_spirit,id=85996,enchant=165int,reforge=haste_crit

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=15785
# gear_intellect=13246
# gear_spirit=5702
# gear_spell_power=5152
# gear_hit_rating=1134
# gear_crit_rating=2470
# gear_haste_rating=4333
# gear_mastery_rating=3001
# gear_armor=40469
# meta_gem=revitalizing_primal
# main_hand=carapace_breaker,weapon=mace_1.90speed_1620min_3009max,enchant=windsong

Sagemanda

Sagemanda : 79950 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
79949.6 79949.6 164.69 / 0.21% 4327 / 5.4% 28.4 2567.2 2540.0 Mana 0.00% 40.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Sagemanda/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Wa!212212
Glyphs
  • flame_shock
  • chain_lightning
  • unleashed_lightning
  • astral_recall
  • spectral_wolf
Professions
  • alchemy: 600
  • tailoring: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:132924|93435|92628|80364|41226&chds=0,265847&chco=C41F3B,336600,C41F3B,62480C,336600&chm=t++132924++lava_burst,C41F3B,0,0,15|t++93435++earth_shock,336600,1,0,15|t++92628++flame_shock,C41F3B,2,0,15|t++80364++elemental_blast,62480C,3,0,15|t++41226++lightning_bolt,336600,4,0,15&chtt=Sagemanda Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,21,9,9,6,6,5,5,3,3,3,2,2,1,1,1,1,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,336600,C41F3B,62480C,336600,C41F3B,C41F3B,336600,336600,62480C,C41F3B,C41F3B,336600,336600,C79C6E,C41F3B,62480C,C41F3B,336600,62480C,336600,C41F3B&chl=lava_burst|lightning_bolt|lava_burst_overload|elemental_blast|lightning_bolt_overload|flame_shock|greater_fire_elemental: fire_melee|fulmination|stormlash|elemental_blast_overload|searing_totem: searing_bolt|lava_burst_eoe|earth_shock|lightning_bolt_eoe|greater_earth_elemental: earth_melee|lava_burst_overload_eoe|elemental_blast_eoe|greater_fire_elemental: fire_blast|lightning_bolt_overload_eoe|elemental_blast_overload_eoe|earth_shock_eoe|flame_shock_eoe&chtt=Sagemanda Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:mpsuwyz0100357778630xuspnkhgdbaYXWVVUUUUUUUUUUUUTSSRRQQQQQRRRRRRRRRRRRRSSTTTTSSRRRQQQPPPPPPPPOOOOOOOPPQQQQQQQQPPPQQQQQRRRRRRRRRRRRSSSSSSRRRRQQPPPPPPPPOOOOOOOOOOPPPQQQQQQQPPPQQQQRRSTUUVWWXYYZabcccccbbaZXXWVUTSSRRQPPOOOOOOPPPQQQQRQQQQQQQQQQQRRRRRRQQQQQQRRRRRRRQQPPPPPOOOOPPPPOOOOOOPPPQQQRRRRQQQQPPQQRSSTUUVVVWWXXYZZabcccbaaZYYXXWWWWVVUUTSSSRSSSTTTTTTTTTTSSRRRRRRSTTUUVWWXYZabcddeeeddcbaZYXWVVUTSRRQQQQQQQQQRRRRRRRRRQQQQQQQQQQQQPPPPPPPPPQQQQQQQPPPPPPPPPPPPPPPPPPPPPPQQQRRQQQQQQPPPPPPPPPPPPPPPPPQQQQQRRQQQQQPPPPPPPPPPPPPPPPPPQQQQQRRQRQQQQPPPPPPPPPQQQPPPPPPQQRR&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.3379,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=79950|max=236607&chxp=1,1,34,100&chtt=Sagemanda DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,0,3,8,9,6,11,13,15,24,26,20,31,33,44,42,41,43,41,35,35,46,39,42,37,46,36,32,28,33,26,24,28,17,21,11,14,6,7,9,4,6,2,2,1,0,0,1&chds=0,46&chbh=5&chxt=x&chxl=0:|min=72685|avg=79950|max=88092&chxp=0,1,47,100&chtt=Sagemanda DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:51.0,23.6,11.1,5.4,4.4,1.4,0.5,0.5&chds=0,100&chdls=ffffff&chco=336600,C41F3B,62480C,336600,C41F3B,C41F3B,C41F3B,336600&chl=lightning_bolt 230.3s|lava_burst 106.5s|elemental_blast 50.0s|earth_shock 24.2s|flame_shock 19.9s|searing_totem 6.3s|fire_elemental_totem 2.1s|earth_elemental_totem 2.1s&chtt=Sagemanda Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Sagemanda 79950
ascendance 0 0.0% 3.0 181.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 2.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)&cooldown.lava_burst.remains>0
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for {$114051d=15 seconds}. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.2 121.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 4.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by {$s1=4514}. Spell power increased by {$s2=2257}.
  • description:Increases your melee attack power by {$s1=4514} and your spell power by {$s2=2257}. Lasts {$d=15 seconds}.
earth_elemental_totem 0 0.0% 1.9 302.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 1.0726 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:nature
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active&cooldown.fire_elemental_totem.remains>=50
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:nature
  • tooltip:
  • description:Summons an Earth Totem with {$s1=154755} health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts {$d=60 seconds}.
earth_shock 1135 (4996) 1.4% (6.3%) 18.9 22.30sec 119481 93435 21562 56198 27111 16.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 1.2788 0.0000 512307.99 512307.99 0.00 93435.12 93435.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.87 83.97% 21562.38 18447 31671 21559.48 19656 23367 342105 342105 0.00
crit 3.03 16.03% 56197.60 47779 82029 53965.09 0 77625 170203 170203 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s2=5412 to 5626} Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by {$115798s1=10}% for {$115798d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 67 0.1% 1.2 135.31sec 25863 0 21032 55167 25859 14.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 1.18 0.00 0.00 0.0000 0.0000 30548.85 30548.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.01 85.85% 21031.79 18447 29971 13446.13 0 29035 21327 21327 0.00
crit 0.17 14.15% 55167.10 47779 77625 8526.30 0 73007 9222 9222 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s2=5412 to 5626} Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by {$115798s1=10}% for {$115798d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
elemental_blast 6390 (8899) 8.0% (11.2%) 29.4 15.39sec 136366 80364 77497 202643 98087 16.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.44 29.39 0.00 0.00 1.6969 0.0000 2882798.10 2882798.10 0.00 80363.89 80363.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.55 83.54% 77497.16 63619 111345 77505.90 73074 81318 1902592 1902592 0.00
crit 4.84 16.46% 202643.29 164772 288385 201534.25 0 288385 980206 980206 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=16646 to 17355} Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by {$118522s1=3500} for {$118522d=8 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_eoe 403 0.5% 1.8 117.04sec 99163 0 77591 204109 99498 17.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.83 1.82 0.00 0.00 0.0000 0.0000 181450.58 181450.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.51 82.71% 77591.03 63619 117826 60528.89 0 117826 117052 117052 0.00
crit 0.32 17.29% 204109.44 164772 305170 56931.27 0 305170 64398 64398 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=16646 to 17355} Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by {$118522s1=3500} for {$118522d=8 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_overload 1998 2.5% 12.3 34.89sec 73145 0 58031 152055 73287 16.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.31 12.28 0.00 0.00 0.0000 0.0000 900219.80 900219.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.29 83.77% 58030.90 47714 83509 58073.08 50100 71094 597131 597131 0.00
crit 1.99 16.23% 152055.03 123580 216289 132331.64 0 216289 303089 303089 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=12485 to 13016} Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
elemental_blast_overload_eoe 109 0.1% 0.7 156.34sec 74347 0 58129 151361 74459 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.67 0.67 0.00 0.00 0.0000 0.0000 49788.17 49788.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.55 82.49% 58129.10 47714 88370 24869.78 0 88370 32061 32061 0.00
crit 0.12 17.51% 151361.08 123580 228879 17167.24 0 228879 17727 17727 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing {$s1=12485 to 13016} Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
fire_elemental_totem 0 0.0% 2.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0738 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=154755} health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts {$d=60 seconds}.
flame_shock 4052 (4081) 5.1% (5.1%) 15.6 29.87sec 118321 92628 11747 30585 14787 16.1% 0.0% 0.0% 0.0% 186.9 6804 17770 8543 15.9% 0.0% 98.7%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.55 15.55 186.94 186.94 1.2774 2.3825 1827032.09 1827032.09 0.00 3954.72 92628.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.04 83.86% 11746.64 10212 17829 11748.00 10776 12974 153178 153178 0.00
crit 2.51 16.14% 30584.70 26450 46177 28685.17 0 42221 76787 76787 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.3 84.14% 6803.70 6125 9864 6805.58 6333 7328 1070165 1070165 0.00
crit 29.7 15.86% 17770.23 15863 25548 17773.42 16255 19387 526903 526903 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every {$t2=3} sec.
  • description:Instantly sears the target with fire, causing {$s1=3695} Fire damage immediately and $o2 Fire damage over {$d=24 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 28 0.0% 0.9 141.69sec 14258 0 11330 30014 14258 15.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.91 0.91 0.00 0.00 0.0000 0.0000 12931.04 12931.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.76 84.33% 11330.06 10212 15290 6206.41 0 14373 8665 8665 0.00
crit 0.14 15.67% 30013.66 26450 37226 3966.61 0 37226 4266 4266 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every {$t2=3} sec.
  • description:Instantly sears the target with fire, causing {$s1=3695} Fire damage immediately and $o2 Fire damage over {$d=24 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 3795 4.8% 18.9 22.30sec 90751 0 72239 188814 90749 15.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 0.0000 0.0000 1714722.49 1714722.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.89 84.12% 72238.62 34260 120968 72267.94 61524 82219 1148092 1148092 0.00
crit 3.00 15.88% 188814.39 88734 313307 181611.39 0 285952 566630 566630 0.00
DPS Timeline Chart

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:Discharges lightning at an attacker, dealing {$s1=2885} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.388000
  • base_dd_min:629.69
  • base_dd_max:629.69
lava_burst 22981 (31500) 28.7% (39.3%) 87.0 5.16sec 162615 132924 41867 118837 118836 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.02 86.89 0.00 0.00 1.2234 0.0000 10325275.28 10325275.28 0.00 132923.57 132923.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 41867.23 41867 41867 41.91 0 41867 42 42 0.00
crit 86.89 100.00% 118837.22 91323 170865 118922.32 114438 124400 10325233 10325233 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4619.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=8632 to 9106} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_eoe 1355 1.7% 5.2 71.28sec 116574 0 37378 116865 116758 99.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.23 5.22 0.00 0.00 0.0000 0.0000 609124.58 609124.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.13% 37377.92 35260 41867 261.91 0 41867 262 262 0.00
crit 5.21 99.87% 116865.15 91323 170865 116158.37 0 170865 608863 608863 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4619.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=8632 to 9106} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_overload 6754 8.4% 34.6 12.82sec 87622 0 0 87855 87855 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.59 34.50 0.00 0.00 0.0000 0.0000 3031251.27 3031251.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 34.50 100.00% 87854.56 68491 128148 87907.28 80169 98306 3031251 3031251 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=6474 to 6829} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lava_burst_overload_eoe 409 0.5% 2.0 116.18sec 90400 0 34303 90734 90567 99.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 2.04 0.00 0.00 0.0000 0.0000 184328.60 184328.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.30% 34302.68 29089 41321 206.02 0 41321 206 206 0.00
crit 2.03 99.70% 90733.51 68491 128148 78699.24 0 128148 184123 184123 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=6474 to 6829} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lightning_bolt 15538 (21026) 19.5% (26.4%) 136.1 3.13sec 69732 41226 41251 107924 51621 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.14 135.90 0.00 0.00 1.6915 0.0000 7015637.85 7015637.85 0.00 41225.84 41225.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.76 84.44% 41251.15 34384 60618 41252.54 40225 42028 4734176 4734176 0.00
crit 21.14 15.56% 107923.81 89054 157002 107856.33 96695 119289 2281462 2281462 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4259.0
  • cooldown:0.00
  • base_execute_time:2.10
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=5481 to 5650} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.739000
  • base_dd_min:1186.04
  • base_dd_max:1355.02
lightning_bolt_eoe 904 1.1% 8.1 46.20sec 50206 0 39933 105354 50284 15.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.13 8.12 0.00 0.00 0.0000 0.0000 408281.83 408281.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.83 84.17% 39932.62 34384 60618 39931.87 0 50151 272872 272872 0.00
crit 1.29 15.83% 105353.58 89054 148180 76447.67 0 148180 135409 135409 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4259.0
  • cooldown:0.00
  • base_execute_time:2.10
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=5481 to 5650} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.739000
  • base_dd_min:1186.04
  • base_dd_max:1355.02
lightning_bolt_overload 4318 5.4% 54.4 7.80sec 35869 0 28727 75148 35997 15.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.36 54.17 0.00 0.00 0.0000 0.0000 1949783.83 1949783.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.68 84.34% 28726.57 24549 43280 28726.70 26743 30272 1312390 1312390 0.00
crit 8.48 15.66% 75148.17 63582 105796 75123.44 64642 97611 637394 637394 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=4109 to 4236} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.554000
  • base_dd_min:889.53
  • base_dd_max:1016.27
lightning_bolt_overload_eoe 266 0.3% 3.4 85.27sec 35619 0 28669 75631 35708 15.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.36 3.35 0.00 0.00 0.0000 0.0000 119658.17 119658.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.85 85.00% 28669.08 24549 40848 27017.19 0 40848 81653 81653 0.00
crit 0.50 15.00% 75630.97 63582 112094 29575.79 0 112094 38005 38005 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=4109 to 4236} Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.554000
  • base_dd_min:889.53
  • base_dd_max:1016.27
searing_totem 0 0.0% 5.9 72.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.85 5.85 0.00 0.00 1.0735 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.fire_elemental_totem.remains>15&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=5} health at your feet for {$d=60 seconds} that repeatedly attacks an enemy within $3606r1 yards for {$3606s1=699 to 720} Fire damage.
stormlash 2548 3.1% 42.7 7.66sec 26497 0 22180 46484 26494 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.67 42.67 0.00 0.00 0.0000 0.0000 1130601.59 1130601.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.09 82.25% 22180.41 8282 45414 22225.08 18103 26098 778429 778429 0.00
crit 7.58 17.75% 46483.62 17062 93553 46578.80 0 69483 352173 352173 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:28244.70
  • base_dd_max:28244.70
pet - greater_fire_elemental 15729 / 4249
fire_blast 1132 0.4% 20.0 18.76sec 6795 0 5415 13798 6793 16.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 19.98 0.00 0.00 0.0000 0.0000 135736.79 135736.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.69 83.54% 5415.36 4529 7898 5415.03 4918 5789 90380 90380 0.00
crit 3.29 16.46% 13797.74 11323 19745 13562.79 0 19745 45357 45357 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 14597 4.9% 105.5 3.41sec 16592 16933 13822 35525 16592 16.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.47 105.47 0.00 0.00 0.9799 0.0000 1749977.60 1749977.60 0.00 16932.86 16932.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.82 59.56% 13822.21 11722 19575 13821.56 13112 14625 868297 868297 0.00
crit 17.38 16.48% 35525.11 29305 48937 35523.44 30859 41343 617465 617465 0.00
glance 25.27 23.96% 10455.22 8792 14681 10456.86 9495 11694 264215 264215 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 3109 / 734
earth_melee 3109 0.9% 63.9 5.19sec 5213 3353 4752 9602 5213 15.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.92 63.92 0.00 0.00 1.5550 0.0000 333235.21 333235.21 0.00 3352.60 3352.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.72 60.57% 4752.41 4332 6135 4750.17 4538 4993 183999 183999 0.00
crit 9.83 15.37% 9602.48 8663 12270 9596.95 0 11606 94370 94370 0.00
glance 15.38 24.06% 3567.93 3249 4601 3568.31 3301 4231 54866 54866 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 2859 / 1917
searing_bolt 2859 2.4% 187.4 2.05sec 4645 0 3728 9749 4667 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.39 186.51 0.00 0.00 0.0000 0.0000 870403.63 870403.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.42 84.41% 3728.08 3127 5272 3728.47 3633 3818 586886 586886 0.00
crit 29.08 15.59% 9748.58 8099 13655 9751.85 8915 10559 283518 283518 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 3.0 0.0 181.3sec 181.3sec 9.71% 9.71%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ascendance_1:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.2 0.0 121.0sec 121.0sec 13.83% 13.83%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.83%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by {$s1=4514}. Spell power increased by {$s2=2257}.
  • description:Increases your melee attack power by {$s1=4514} and your spell power by {$s2=2257}. Lasts {$d=15 seconds}.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.50%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
elemental_blast_crit 10.5 0.0 40.2sec 40.2sec 17.47% 17.47%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_elemental_blast_crit
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_crit_1:17.47%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_haste 10.3 0.0 40.6sec 40.6sec 17.25% 17.25%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_haste_1:17.25%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_mastery 10.4 0.0 40.0sec 40.0sec 17.38% 17.38%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_mastery_1:17.38%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_focus 61.4 59.4 7.3sec 3.7sec 57.73% 58.95%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_focus_1:32.54%
  • elemental_focus_2:25.19%

Trigger Attempt Success

  • trigger_pct:99.51%

Spelldata details

  • id:16246
  • name:Clearcasting
  • tooltip:Your next $n spells have their mana cost reduced by {$s1=25}%. Spell damage increased by {$s2=10}%. Single-target healing done increased by {$s4=50}%.
  • description:After landing a critical strike with a Fire, Frost, or Nature damage spell, you enter a Clearcasting state. The Clearcasting state reduces the mana cost of your next $16246n spells by {$16246s1=25}%, increases your spell damage by {$s2=10}%, and increases single-target healing done by {$s4=50}%.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
jade_serpent_potion 1.0 0.0 302.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
lightweave_embroidery_3 7.9 0.0 60.2sec 60.2sec 25.86% 25.86%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:57.00
  • default_chance:25.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.86%

    Trigger Attempt Success

    • trigger_pct:25.52%
relic_of_yulon 8.8 0.0 53.8sec 53.8sec 28.68% 28.68%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.68%

    Trigger Attempt Success

    • trigger_pct:20.53%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
windsong_crit 5.8 1.1 69.2sec 56.8sec 16.54% 16.20%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:16.54%

    Trigger Attempt Success

    • trigger_pct:4.33%
windsong_haste 5.7 1.0 69.4sec 57.0sec 16.35% 16.22%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:16.35%

    Trigger Attempt Success

    • trigger_pct:4.26%
windsong_mastery 5.8 1.0 68.3sec 56.4sec 16.53% 16.06%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:16.53%

    Trigger Attempt Success

    • trigger_pct:4.30%
zen_alchemist_stone_int 8.3 0.0 57.3sec 57.3sec 27.30% 27.30%

Buff details

  • buff initial source:Sagemanda
  • cooldown name:buff_zen_alchemist_stone_int
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:35.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4040.73

    Stack Uptimes

    • zen_alchemist_stone_int_1:27.30%

    Trigger Attempt Success

    • trigger_pct:33.98%

Spelldata details

  • id:105574
  • name:Zen Alchemist Stone
  • tooltip:
  • description:When you heal or deal damage you have a chance to increase your Strength, Agility, or Intellect by {$s1=4041} for {$60229d=15 seconds}. Your highest stat is always chosen.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:35.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Sagemanda
ascendance Mana 3.0 9222.7 3120.0 3120.0 0.0
bloodlust Mana 0.8 10125.7 12899.0 12886.1 0.0
earth_elemental_totem Mana 1.9 32860.1 16860.0 16860.4 0.0
earth_shock Mana 18.9 143169.1 7577.5 7577.1 15.8
fire_elemental_totem Mana 2.0 32278.0 16139.0 16139.0 0.0
flame_shock Mana 15.6 101043.5 6497.6 6497.7 18.2
lava_burst Mana 87.0 333734.3 3835.4 3835.4 42.4
lightning_bolt Mana 136.1 474749.7 3487.2 3487.2 20.0
searing_totem Mana 5.9 20716.1 3540.0 3540.1 0.0
wind_shear Mana 0.0 159.3 5139.7 5134.5 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1803.90 607765.93 (53.04%) 336.92 68695.44 10.16%
rolling_thunder Mana 116.19 538042.66 (46.96%) 4630.87 159073.34 22.82%
Resource RPS-Gain RPS-Loss
Mana 2540.04 2567.19
Combat End Resource Mean Min Max
Health 399901.00 399901.00 399901.00
Mana 287747.34 245594.00 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
spirit_wolf-Mana Cap 10.1%
primal_fire_elemental-Mana Cap 10.1%
primal_earth_elemental-Mana Cap 10.1%
earth_elemental_totem-Mana Cap 10.1%
magma_totem-Mana Cap 10.1%
stormlash_totem-Mana Cap 10.1%

Procs

Count Interval
lava_surge 37.2 11.8sec
lightning_shield_too_fast_fill 0.0 nansec
rolling_thunder 116.2 3.7sec
wasted_lightning_shield 9.3 40.1sec
wasted_lightning_shield_shock_cd 0.0 nansec
fulmination_3 1.5 116.6sec
fulmination_4 1.6 119.7sec
fulmination_5 1.3 127.1sec
fulmination_6 14.5 29.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Sagemanda Damage Per Second
Count 999
Mean 79949.63
Minimum 72685.07
Maximum 88091.76
Spread ( max - min ) 15406.69
Range [ ( max - min ) / 2 * 100% ] 9.64%
Standard Deviation 2655.8194
5th Percentile 75754.73
95th Percentile 84408.18
( 95th Percentile - 5th Percentile ) 8653.45
Mean Distribution
Standard Deviation 84.0264
95.00% Confidence Intervall ( 79784.94 - 80114.32 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4238
0.1 Scale Factor Error with Delta=300 60211
0.05 Scale Factor Error with Delta=300 240846
0.01 Scale Factor Error with Delta=300 6021168
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 79949.63
Distribution Chart

Damage

Sample Data
Count 999
Mean 32885742.10
Distribution Chart

DTPS

Sample Data Sagemanda Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Sagemanda Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Sagemanda Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 306.70
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 flametongue_weapon,weapon=main
3 0.00 lightning_shield,if=!buff.lightning_shield.up
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.03 wind_shear
7 0.79 bloodlust,if=target.health.pct<25|time>5
8 0.00 stormlash_totem,if=!active&!buff.stormlash.up&(buff.bloodlust.up|time>=60)
9 1.00 jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
A 0.00 run_action_list,name=single,if=active_enemies=1
B 0.00 run_action_list,name=ae,if=active_enemies>1
actions.single
# count action,conditions
C 4.25 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
D 0.00 elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
E 2.00 fire_elemental_totem,if=!active
F 2.96 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)&cooldown.lava_burst.remains>0
G 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
H 0.00 unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
I 87.27 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
J 15.55 flame_shock,if=ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
K 29.54 elemental_blast,if=talent.elemental_blast.enabled
L 14.23 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
M 4.66 earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
N 1.95 earth_elemental_totem,if=!active&cooldown.fire_elemental_totem.remains>=50
O 5.85 searing_totem,if=cooldown.fire_elemental_totem.remains>15&!totem.fire.active
P 0.00 spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))|(buff.raid_movement.duration>=action.unleash_elements.gcd+action.earth_shock.gcd)
Q 136.63 lightning_bolt

Sample Sequence

EJIKCFIIIIIIIIIIIIIIIKQQQJQQIQILKQQQQIQLQIKQQQIJQNOLKIQQQQQIQKLQQIQJQQKIQQQQLIQKQQQIQJQIKLOQCQQIQQKIQQILQQQJIKQQQQIQQKLQIQQQJQIKOQFIIIIIIIIIIIIKMQQQJIQQIKQIQQQQQIKLQQQJIOQCKQQQIQLQQKIQQQIJQQKQIQLQIQIQKQMIQQE9JQKIQQIQLQQKIQQMQQIJIKQQQQIQLQKQIQQQJQIKNOFCIIIIIIIIIIIIKMQIQJQQQIKIQQQLQIQIKQQJQIQQLKOQIQQQQQIKQJQQILQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 180 171 80
Stamina 18107 16461 16299
Intellect 16538 14049 13233
Spirit 4456 4456 4285
Health 399901 376857 0
Mana 300000 300000 0
Spell Power 24574 19851 5812
Spell Hit 15.01% 15.01% 820
Spell Crit 16.01% 10.03% 1372
Spell Haste 20.65% 14.90% 6333
ManaReg per Second 1500 1500 0
Attack Power 788 687 0
Melee Hit 15.01% 15.01% 820
Melee Crit 10.35% 5.34% 1372
Melee Haste 14.90% 14.90% 6333
Swing Speed 26.39% 14.90% 6333
Expertise 0.00% 0.00% 0
Armor 40109 40109 40109
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 37.04% 27.04% 3310

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Sagemanda"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Sagemanda/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/30/67620894-avatar.jpg"
level=90
race=orc
spec=elemental
role=spell
position=back
professions=tailoring=600/alchemy=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!212212
glyphs=flame_shock/chain_lightning/unleashed_lightning/astral_recall/spectral_wolf

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/flametongue_weapon,weapon=main
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/stormlash_totem,if=!active&!buff.stormlash.up&(buff.bloodlust.up|time>=60)
actions+=/jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=active_enemies=1
actions+=/run_action_list,name=ae,if=active_enemies>1

actions.single=blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
actions.single+=/fire_elemental_totem,if=!active
actions.single+=/ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)&cooldown.lava_burst.remains>0
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/flame_shock,if=ticks_remain<3&(ticks_remain<2|buff.bloodlust.up|buff.elemental_mastery.up)
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
actions.single+=/earth_elemental_totem,if=!active&cooldown.fire_elemental_totem.remains>=50
actions.single+=/searing_totem,if=cooldown.fire_elemental_totem.remains>15&!totem.fire.active
actions.single+=/spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))|(buff.raid_movement.duration>=action.unleash_elements.gcd+action.earth_shock.gcd)
actions.single+=/lightning_bolt

actions.ae=ascendance
actions.ae+=/lava_beam
actions.ae+=/magma_totem,if=active_enemies>2&!totem.fire.active
actions.ae+=/searing_totem,if=active_enemies<=2&!totem.fire.active
actions.ae+=/lava_burst,if=active_enemies<3&dot.flame_shock.remains>cast_time&cooldown_react
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking&active_enemies<3
actions.ae+=/earthquake,if=active_enemies>4
actions.ae+=/thunderstorm,if=mana.pct_nonproc<80
actions.ae+=/chain_lightning,if=mana.pct_nonproc>10
actions.ae+=/lightning_bolt

head=sixteenfanged_crown,id=86745,gems=burning_primal_80int_160spi_180int
neck=mending_necklace_of_the_golden_lotus,id=90595,reforge=spi_haste
shoulders=shoulders_of_empyreal_focus,id=86141,gems=160int_60int,enchant=200int_100crit
back=stormwake_mistcloak,id=86182,enchant=lightweave_embroidery_3,reforge=crit_haste
chest=firebirds_hauberk,id=86629,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
wrists=brewmaster_chanis_bracers,id=88883,enchant=170mastery,reforge=crit_mastery
hands=firebirds_gloves,id=85290,enchant=170haste
waist=klaxxi_lash_of_the_precursor,id=89059,gems=80int_160spi_160int_60mastery,reforge=mastery_spi
legs=leggings_of_imprisoned_will,id=86040,gems=160int_80int_160spi_120int,enchant=285int_165spi,reforge=mastery_haste
feet=boots_of_unbreakable_umbrage,id=90907,enchant=175haste,reforge=crit_haste
finger1=seal_of_the_profane,id=86858,reforge=mastery_haste
finger2=simple_harmonius_ring,id=89072
trinket1=relic_of_yulon,id=79331
trinket2=zen_alchemist_stone,id=75274,reforge=mastery_haste
main_hand=tihan_scepter_of_the_sleeping_emperor,id=86806,enchant=windsong,reforge=mastery_haste
off_hand=eye_of_the_ancient_spirit,id=86764,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=16299
# gear_intellect=13233
# gear_spirit=4285
# gear_spell_power=5812
# gear_hit_rating=820
# gear_crit_rating=1372
# gear_haste_rating=6333
# gear_mastery_rating=3310
# gear_armor=40109
# meta_gem=burning_primal
# tier14_2pc_caster=1
# back=stormwake_mistcloak,enchant=lightweave_embroidery_3
# trinket2=zen_alchemist_stone
# main_hand=tihan_scepter_of_the_sleeping_emperor,weapon=mace_2.40speed_2310min_4291max,enchant=windsong

Maguth

Maguth : 88905 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
88904.9 88904.9 150.94 / 0.17% 3901 / 4.4% 15.8 5545.5 4965.9 Mana 0.00% 27.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Maguth/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Va!112121
Glyphs
  • soul_swap
  • siphon_life
  • soul_shards
  • eye_of_kilrogg
  • verdant_spheres
  • soulwell
Professions
  • tailoring: 600
  • enchanting: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:263479|149509|141029|77960|76958|61018|18636&chds=0,526958&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++263479++agony,9482C9,0,0,15|t++149509++corruption,9482C9,1,0,15|t++141029++unstable_affliction,9482C9,2,0,15|t++77960++haunt,9482C9,3,0,15|t++76958++drain_soul,9482C9,4,0,15|t++61018++malefic_grasp,9482C9,5,0,15|t++18636++soul_swap,9482C9,6,0,15&chtt=Maguth Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,13,11,11,10,9,9,8,4,2,2,2,2,1,1,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,336600,9482C9,9482C9,9482C9,9482C9,9482C9&chl=agony|unstable_affliction|corruption|agony_mg|unstable_affliction_mg|haunt|malefic_grasp|corruption_mg|drain_soul|agony_ds|unstable_affliction_ds|stormlash|corruption_ds|doomguard: doom_bolt|touch_of_the_grave|soul_swap|felhunter: shadow_bite&chtt=Maguth Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:dfihjmnnrtvy14556655877554221zvtrpnmmlkjiggfffedcbaaaaaaZZZYYYYXWWWVVWVVWWWWWWWWWVVVUUUUUUUUUUUTTTSSSSSSTTUUUUUTTTUUUVVVWWXXYYYYYZZaaaaaaaaaZZYYXXXXXXWWWWWWWWWWVVVVVVVVUUUUUTTTSSSSSTTTUUUUTTTTTTUUUUUUVVVVVUUUVVVVVVVUUUUUTTTTTTTTTTTTSSSSTTUVWXXYZaabbbcccdddeeeddccbbaZYYXXXWWWVVVVUUUUTTTUUUUUUUUUUVVVVWWWXXYYYYZZZZZZZZZYYYYYYXXXXWWVVVVVWWWWXXXXXWWWXXXXXXYYYYYYYYZZZaaabbbccdddeeeeeeeeeeeeeeeddcccbbbbaaaaaZZZYYYYZZZZZZZZZZZZZaaaaabbbbbbbbbbbbbcbbbbbbbbaaaaaaaaaaaaZZZaaaaaaaaabbbbccccddeeeefffffggggggggfffeeeddddcccbbbbaaaaaaaaaaaaabbbbbaaaaaaaZZZZZYYYYXXX&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4320,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=88905|max=205812&chxp=1,1,43,100&chtt=Maguth DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,0,1,2,0,5,5,9,7,7,15,19,21,26,29,36,49,40,46,55,51,49,35,41,51,43,48,29,35,25,33,24,36,28,17,22,9,12,10,3,4,8,2,4,2,0,1,1,1&chds=0,55&chbh=5&chxt=x&chxl=0:|min=81614|avg=88905|max=96681&chxp=0,1,48,100&chtt=Maguth DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:53.9,12.2,10.3,8.3,6.7,5.0,2.4,0.9,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=malefic_grasp 243.0s|drain_soul 55.1s|haunt 46.3s|unstable_affliction 37.5s|corruption 30.1s|agony 22.4s|life_tap 10.9s|soul_swap 4.2s|summon_doomguard 1.1s&chtt=Maguth Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Maguth 88905
agony 13082 14.7% 17.4 25.17sec 339174 263479 0 0 0 0.0% 8.4% 0.0% 0.0% 290.7 17064 35706 20266 17.2% 0.0% 99.3%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.37 21.33 290.73 290.73 1.2873 1.5410 5891919.94 5891919.94 0.00 12525.90 263479.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.54 91.61% 0.00 0 0 0.00 0 0 0 0 0.00
miss 1.79 8.39% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 240.8 82.82% 17064.00 2959 27091 17079.84 16042 18381 4108547 4108547 0.00
crit 49.9 17.18% 35706.22 6096 55807 35756.61 32217 43836 1783373 1783373 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing up to ${$o4*10} Shadow damage over {$d=24 seconds}. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_ds 2153 2.4% 30.1 2.75sec 32380 0 27426 56864 32384 16.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.09 30.09 0.00 0.00 0.0000 0.0000 974395.81 974395.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.03 83.17% 27426.33 18605 40636 27439.93 23320 32871 686383 686383 0.00
crit 5.07 16.83% 56863.72 38326 83710 56629.33 0 79897 288013 288013 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing up to ${$o4*10} Shadow damage over {$d=24 seconds}. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_mg 9403 10.6% 281.9 1.29sec 15004 0 12632 26466 15005 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 281.85 281.85 0.00 0.00 0.0000 0.0000 4229061.27 4229061.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 233.50 82.84% 12631.72 3329 20318 12646.65 11787 13836 2949416 2949416 0.00
crit 48.35 17.16% 26466.35 6858 41855 26494.44 23748 30200 1279645 1279645 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing up to ${$o4*10} Shadow damage over {$d=24 seconds}. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption 9991 11.2% 23.3 18.85sec 193374 149509 0 0 0 0.0% 8.4% 0.0% 0.0% 288.9 13137 27411 15574 17.1% 0.0% 99.3%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.27 27.22 288.91 288.91 1.2934 1.5505 4499477.80 4499477.80 0.00 9411.89 149509.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.95 91.65% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.27 8.35% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 239.6 82.92% 13136.96 9538 20836 13147.52 12395 14243 3147283 3147283 0.00
crit 49.3 17.08% 27410.69 19649 42922 27430.33 25003 31408 1352195 1352195 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_ds 1658 1.9% 30.1 2.75sec 24943 0 21044 43764 24944 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.07 30.07 0.00 0.00 0.0000 0.0000 750079.52 750079.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.91 82.84% 21043.91 14307 31254 21070.61 18377 24680 524242 524242 0.00
crit 5.16 17.16% 43763.63 29473 64382 43649.73 0 59461 225837 225837 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_mg 7236 8.1% 281.9 1.29sec 11548 0 9734 20361 11548 17.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 281.85 281.85 0.00 0.00 0.0000 0.0000 3254944.59 3254944.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 233.72 82.92% 9733.69 7154 15627 9743.13 9148 10537 2274878 2274878 0.00
crit 48.14 17.08% 20360.92 14737 32191 20382.92 18519 23314 980066 980066 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over {$d=18 seconds}.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 4.3 121.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.27 4.27 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Spell haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by {$113860s1=30}% for {$113860d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your spell haste by ${{$113860m1=30}/{$56228m1=10}}%. This effect is disabled while on cooldown.][]
drain_soul 3579 (9369) 4.0% (10.6%) 17.2 5.00sec 246635 76958 0 0 0 0.0% 8.5% 0.0% 0.0% 30.1 45316 94234 53789 17.3% 0.0% 10.9%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.18 17.18 30.09 30.09 3.2048 1.6340 1618404.03 1618404.03 0.00 76957.90 76957.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.73 91.52% 0.00 0 0 0.00 0 0 0 0 0.00
miss 1.46 8.48% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.9 82.69% 45316.23 30885 67467 45362.25 41338 50707 1127636 1127636 0.00
crit 5.2 17.31% 94233.82 63623 138981 93925.93 0 117302 490768 490768 0.00
DPS Timeline Chart

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4499.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=20
Spelldata
  • id:1120
  • name:Drain Soul
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the warlock's other periodic Affliction damage effects to instantly deal {$s5=100}% of their normal periodic damage, every {$t1=2} seconds.
  • description:Drains the soul of the target, causing ${{$m1=1}+$SP*0.375} Shadow damage every {$t1=2} sec and energizing one Soul Shard after it deals damage twice. If the target dies, three Soul Shards are energized. Lasts {$d=12 seconds}. If the target is at or below {$s3=20}% health when Drain Soul deals damage, it deals {$s6=100}% additional damage and causes all of your other periodic Affliction damage effects to instantly deal {$s5=100}% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.390000
  • base_td:416.60
  • num_ticks:6
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
haunt 8021 9.0% 36.3 12.61sec 99611 77960 92036 192047 100303 15.8% 8.2% 0.0% 0.0% 129.7 0 0 0 0.0% 0.0% 57.5%

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.27 36.02 129.73 129.73 1.2777 2.0000 3613200.54 3613200.54 0.00 11815.26 77959.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.38 76.02% 92036.22 69289 151363 92029.65 83523 100377 2520261 2520261 0.00
crit 5.69 15.80% 192046.85 142736 311808 191884.25 0 311808 1092940 1092940 0.00
miss 2.95 8.18% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.7 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react&miss_react
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Spell damage taken from the caster is increased by {$s3=25}%.
  • description:You send a ghostly soul into the target, dealing {$s1=13356} Shadow damage and increasing all damage done by your spells on the target by {$s3=25}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.750000
  • base_dd_min:1869.36
  • base_dd_max:1869.36
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
life_tap 0 0.0% 8.4 45.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.39 8.39 0.00 0.00 1.2971 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<35
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:{$?s63320=false}[Places a stacking heal absorb effect on you for {$d=0 milliseconds} equal to {$m3=15}% of your total health and restores][Restores] ${{$m1=15}*$MHP*0.01} mana.{$?s63320=false}[ Lasts {$d=0 milliseconds}.][]
malefic_grasp 7848 (32961) 8.8% (37.0%) 89.9 4.04sec 164995 61018 0 0 0 0.0% 8.4% 0.0% 0.0% 281.9 10604 22031 12531 16.9% 0.0% 49.3%

Stats details: malefic_grasp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.87 89.87 281.85 281.85 2.7040 0.7893 3531862.87 3531862.87 0.00 61018.21 61018.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.34 91.62% 0.00 0 0 0.00 0 0 0 0 0.00
miss 7.53 8.38% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 234.3 83.14% 10604.39 7919 17299 10610.30 9940 11319 2484861 2484861 0.00
crit 47.5 16.86% 22030.76 16314 35637 22044.07 20285 24426 1047002 1047002 0.00
DPS Timeline Chart

Action details: malefic_grasp

Static Values
  • id:103103
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4499.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103103
  • name:Malefic Grasp
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the Warlock's other periodic Affliction damage effects to instantly deal {$s3=50}% of their normal periodic damage, every {$t1=1} seconds.
  • description:Binds the target in twilight, causing $103103o1 Shadow damage over {$103103d=4 seconds}. Every {$t1=1} sec, when Malefic Grasp deals damage, it causes all of your other periodic Affliction damage effects to instantly deal {$s3=50}% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
soul_swap 176 0.2% 4.0 146.18sec 19998 18636 18399 38258 19997 15.8% 8.4% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_swap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 3.96 0.00 0.00 1.0731 0.0000 79111.17 79111.17 0.00 18636.32 18636.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.00 75.81% 18398.83 13198 27517 18188.88 0 26255 55176 55176 0.00
crit 0.63 15.81% 38258.50 27188 56112 18754.69 0 56112 23935 23935 0.00
miss 0.33 8.38% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_swap

Static Values
  • id:86121
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:17999.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.soulburn.up
Spelldata
  • id:86121
  • name:Soul Swap
  • school:shadow
  • tooltip:
  • description:You instantly deal {$86121s1=3816} damage{$?s56226=true}[ and copy your Shadow damage-over-time effects from the target][, and remove your Shadow damage-over-time effects from the target]. For {$86211d=20 seconds} afterwards, the next target you cast Soul Swap: Exhale on will be afflicted by the Shadow damage-over-time effects and suffer {$86121s1=3816} damage. You cannot Soul Swap to the same target.{$?s74434=true}&!s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFApplies Corruption, Unstable Affliction and Agony without removing them from a target.|r][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:534.10
  • base_dd_max:534.10
soulburn 0 0.0% 5.7 92.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.71 5.71 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up&shard_react
Spelldata
  • id:74434
  • name:Soulburn
  • school:shadow
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life{$?s103111=false}[ Fear][]{$?s103101=false}[ Health Funnel][]{$?s103112=false}[ Curses][]{$?s104243=false}[ Demonic Circle: Teleport][]{$?s86664=false}[ Seed of Corruption][]$?s5697[ Unending Breath][]{$?s86121=true}[ Soul Swap][]
stormlash 1750 1.9% 37.9 8.63sec 20522 0 18672 39231 20524 16.5% 8.3% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.93 37.93 0.00 0.00 0.0000 0.0000 778403.43 778403.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.52 75.19% 18672.17 7582 27005 18682.87 15732 21735 532546 532546 0.00
crit 6.27 16.52% 39230.55 15619 55630 39291.70 20066 55630 245857 245857 0.00
miss 3.14 8.29% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:14442.78
  • base_dd_max:14442.78
touch_of_the_grave 580 0.7% 18.2 25.10sec 14364 0 14364 0 14364 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 0.00 0.00 0.0000 0.0000 261499.57 261499.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.21 100.00% 14364.00 14364 14364 14364.00 14364 14364 261500 261500 0.00
DPS Timeline Chart

Action details: touch_of_the_grave

Static Values
  • id:5227
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5227
  • name:Touch of the Grave
  • school:physical
  • tooltip:
  • description:Your attacks and damaging spells have a chance to drain the target, dealing {$127802s1=12654 to 14706} Shadow damage and healing you for the same amount.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:13680.00
  • base_dd_max:13680.00
unstable_affliction 11731 13.2% 29.3 15.06sec 180378 141029 0 0 0 0.0% 8.5% 0.0% 0.0% 288.2 15481 32330 18342 17.0% 0.0% 99.0%

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.31 33.26 288.20 288.20 1.2790 1.5493 5286207.27 5286207.27 0.00 10921.98 141029.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.44 91.51% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.82 8.49% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 239.3 83.02% 15480.67 11444 25001 15490.45 14603 16415 3703836 3703836 0.00
crit 48.9 16.98% 32330.29 23576 51502 32350.44 29118 35520 1582371 1582371 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for {$31117d=4 seconds}.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over {$d=14 seconds}. If the Unstable Affliction is dispelled it will cause ${{$m3=1}*7} damage to the dispeller{$?s56233=false}[ and $ghis:her; target.][ and silence them for {$31117d=4 seconds}.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_ds 1980 2.2% 30.1 2.75sec 29762 0 25109 52184 29762 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.08 30.08 0.00 0.00 0.0000 0.0000 895346.16 895346.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.91 82.81% 25109.21 17167 37502 25140.25 21999 29108 625553 625553 0.00
crit 5.17 17.19% 52184.35 35363 77253 52175.62 0 70351 269793 269793 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for {$31117d=4 seconds}.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over {$d=14 seconds}. If the Unstable Affliction is dispelled it will cause ${{$m3=1}*7} damage to the dispeller{$?s56233=false}[ and $ghis:her; target.][ and silence them for {$31117d=4 seconds}.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_mg 8472 9.5% 281.9 1.29sec 13528 0 11440 23835 13528 16.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 281.85 281.85 0.00 0.00 0.0000 0.0000 3812837.03 3812837.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 234.37 83.15% 11439.53 8583 18751 11447.19 10808 12363 2680986 2680986 0.00
crit 47.49 16.85% 23835.11 17682 38627 23851.69 21732 26970 1131851 1131851 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${{$t1=2}/2000}.2][{$t1=2}] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for {$31117d=4 seconds}.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over {$d=14 seconds}. If the Unstable Affliction is dispelled it will cause ${{$m3=1}*7} damage to the dispeller{$?s56233=false}[ and $ghis:her; target.][ and silence them for {$31117d=4 seconds}.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
pet - felhunter 0 / 29
shadow_bite 0 0.0% 1.0 nansec 12877 12000 11966 23932 12888 15.9% 8.3% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0738 0.0000 12876.52 12876.52 0.00 12000.48 12000.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.76 75.78% 11966.18 11966 11966 9067.46 0 11966 9067 9067 0.00
crit 0.16 15.92% 23932.36 23932 23932 3809.05 0 23932 3809 3809 0.00
miss 0.08 8.31% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:
  • description:Bite the enemy, causing {$s1=2900} Shadow damage.$?a104315[ Master gains {$s3=12} Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.380000
  • base_dd_min:405.92
  • base_dd_max:405.92
pet - doomguard 8988 / 1215
doom_bolt 8988 1.3% 17.0 3.40sec 31723 9330 29275 59904 31724 15.9% 8.3% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 3.4000 0.0000 539282.77 539282.77 0.00 9330.15 9330.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.89 75.84% 29275.32 23756 41516 29274.64 25773 33193 377440 377440 0.00
crit 2.70 15.89% 59904.09 47512 83033 56991.22 0 83033 161843 161843 0.00
miss 1.41 8.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=6821 to 6917} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 13.32%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 4.3 0.0 121.3sec 121.4sec 18.53% 20.86%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Spell haste increased by {$s1=30}%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by {$113860s1=30}% for {$113860d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your spell haste by ${{$113860m1=30}/{$56228m1=10}}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
jade_serpent_potion 1.0 0.0 366.7sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 11.9 7.9 37.7sec 22.1sec 41.19% 41.74%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:41.19%

    Trigger Attempt Success

    • trigger_pct:1.64%
light_of_the_cosmos 10.0 0.0 46.8sec 46.8sec 43.54% 43.54%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3236.00

    Stack Uptimes

    • light_of_the_cosmos_1:43.54%

    Trigger Attempt Success

    • trigger_pct:12.47%
lightweave_embroidery_3 8.2 0.0 58.3sec 58.3sec 26.83% 26.83%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:57.00
  • default_chance:25.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:2000.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.83%

    Trigger Attempt Success

    • trigger_pct:18.21%
mithril_wristwatch 7.1 0.0 65.1sec 65.1sec 15.63% 15.63%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_mithril_wristwatch
  • max_stacks:1
  • duration:10.00
  • cooldown:45.00
  • default_chance:10.00%
  • default_value:0.00
  • Stat Buff details

    • stat:spell_power
    • amount:5082.00

    Stack Uptimes

    • mithril_wristwatch_1:15.63%

    Trigger Attempt Success

    • trigger_pct:10.40%
soulburn 4.4 1.3 126.6sec 92.9sec 4.59% 100.00%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_soulburn
  • max_stacks:1
  • duration:30.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • soulburn_1:4.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:74434
  • name:Soulburn
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life{$?s103111=false}[ Fear][]{$?s103101=false}[ Health Funnel][]{$?s103112=false}[ Curses][]{$?s104243=false}[ Demonic Circle: Teleport][]{$?s86664=false}[ Seed of Corruption][]$?s5697[ Unending Breath][]{$?s86121=true}[ Soul Swap][]
  • max_stacks:
  • duration:30.00
  • cooldown:1.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
grimoire_of_sacrifice

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:3600.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[{$@spelldesc132612=Damage dealt by Malefic Grasp, Drain Soul, Haunt and Fel Flame increased by {$108503m3=50}%.}][]$?$w4>0[{$@spelldesc132613=Damage dealt by Shadow Bolt, Soul Fire, Hand of Gul'dan, Metamorphosis Melee, Wild Imps and Fel Flame increased by {$108503m4=30}%.}][]$?$w5>0[{$@spelldesc132614=Damage dealt by Incinerate, Conflagrate, Shadowburn and Fel Flame increased by {$108503m5=25}%. Spells modified by Fire and Brimstone are unaffected. Chaos Bolt deals {$108503m5=25}% additional damage over ${{$108503m1=0}2/1000} sec.}][] {$?s108415=false}[ Maximum health increased by {$108503s7=20}%. ][]Restores {$108503s2=2}% of maximum health every {$108503t2=5} sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[{$s5=25}% to {$s3=50}][]$?c1[{$s3=50}][]$?c2[{$s4=30}][]$?c3[{$s5=25}][]%{$?s108415=false}[, increase your maximum health by {$s7=20}%,][] and regenerate {$s2=2}% of maximum health every {$t2=5} sec. Lasts for {$d=3600 seconds}. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:3600.00
  • cooldown:30.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Maguth
agony Mana 17.4 52128.0 3000.0 3000.8 113.0
corruption Mana 23.3 87251.2 3750.0 3749.8 51.6
dark_soul Mana 4.3 64110.0 15000.0 14999.0 0.0
drain_soul Mana 47.3 348132.6 7362.7 20258.9 12.2
haunt Soul Shard 36.3 36.3 1.0 1.0 99603.1
malefic_grasp Mana 371.7 1672269.3 4499.0 18606.8 8.9
soul_swap Mana 4.0 71204.0 17999.0 17999.2 1.1
soulburn Soul Shard 5.7 5.7 1.0 1.0 0.0
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 0.0
unstable_affliction Mana 29.3 131856.7 4499.0 4499.3 40.1
pet - felhunter
shadow_bite Energy 1.0 60.0 60.0 60.0 214.6
pet - doomguard
doom_bolt Energy 17.0 595.0 35.0 35.0 906.4
Resource Gains Type Count Total Average Overflow
drain_soul Soul Shard 11.10 11.05 (28.55%) 0.99 0.06 0.51%
life_tap Mana 8.38 540780.93 (24.14%) 64493.85 0.00 0.00%
mp5_regen Mana 1803.90 1699339.66 (75.86%) 942.04 0.00 0.00%
touch_of_the_grave Health 18.20 31672.64 (8.87%) 1739.97 229795.25 87.89%
soul_leech Health 345.00 142356.23 (39.86%) 412.62 1610442.16 91.88%
nightfall Soul Shard 27.66 27.64 (71.45%) 1.00 0.02 0.08%
siphon_life Health 600.82 183112.28 (51.27%) 304.77 1517757.97 89.23%
pet - doomguard
energy_regen Energy 239.00 582.05 (100.00%) 2.44 209.10 26.43%
Resource RPS-Gain RPS-Loss
Health 1184.52 1198.81
Mana 4965.91 5545.52
Soul Shard 0.09 0.09
Combat End Resource Mean Min Max
Health 423508.12 365465.15 429959.00
Mana 38567.90 0.00 105112.69
Soul Shard 0.70 0.00 4.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
touch_of_the_grave 18.2 25.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Maguth Damage Per Second
Count 999
Mean 88904.86
Minimum 81613.80
Maximum 96680.64
Spread ( max - min ) 15066.84
Range [ ( max - min ) / 2 * 100% ] 8.47%
Standard Deviation 2434.0290
5th Percentile 85136.61
95th Percentile 92938.28
( 95th Percentile - 5th Percentile ) 7801.67
Mean Distribution
Standard Deviation 77.0093
95.00% Confidence Intervall ( 88753.92 - 89055.79 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2879
0.1 Scale Factor Error with Delta=300 50574
0.05 Scale Factor Error with Delta=300 202299
0.01 Scale Factor Error with Delta=300 5057491
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 88904.86
Distribution Chart

Damage

Sample Data
Count 999
Mean 39476750.99
Distribution Chart

DTPS

Sample Data Maguth Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Maguth Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Maguth Healing taken Per Second
Count 999
Mean 390.92
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 203.89
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
8 4.27 dark_soul
9 0.00 service_pet,if=talent.grimoire_of_service.enabled
A 1.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
B 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
C 0.00 run_action_list,name=aoe,if=active_enemies>3
D 1.00 summon_doomguard
E 3.96 soul_swap,if=buff.soulburn.up
F 36.41 haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react&miss_react
G 0.00 soul_swap,cycle_targets=1,if=active_enemies>1&time<10&glyph.soul_swap.enabled
H 0.00 haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1&miss_react
I 2.24 soulburn,line_cd=20,if=buff.dark_soul.up&shard_react
J 3.46 soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
K 17.38 agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
L 23.27 corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
M 29.31 unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
N 17.18 drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
O 8.38 life_tap,if=mana.pct<35
P 55.04 malefic_grasp,chain=1
Q 0.00 life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
R 0.00 fel_flame,moving=1
S 0.00 life_tap

Sample Sequence

8ADFIELPFMPKLPFPFMPFLPFKMPFPFLMPFOKPLMPFMKLPPFPMOPLFPKP8MPFLPMPOPKPFPLMPFPKLMPPOMPFLPKPMPLPMOPFKPLPMFP8KLMPOPPFPMPLPFPFKKKMPLPMFKPOPLPMPFPPKLMMPFPLMOPKPFMPFLP8MPKP7FNLNFNMNIENFNFNFJMNJLFNJKENFNNFNMNFJLNNOKNENFN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 153 146 80
Agility 163 155 80
Stamina 20254 18413 16635
Intellect 15329 13234 12419
Spirit 625 625 422
Health 429959 404185 0
Mana 300000 300000 0
Soul Shard 4 4 0
Spell Power 24071 19788 6564
Spell Hit 6.68% 6.68% 2270
Spell Crit 18.64% 12.81% 3535
Spell Haste 15.78% 10.27% 4363
ManaReg per Second 3473 3308 0
Attack Power 304 262 0
Melee Hit 6.68% 6.68% 2270
Melee Crit 13.72% 8.71% 3535
Melee Haste 10.27% 10.27% 4363
Swing Speed 21.29% 10.27% 4363
Expertise 0.00% 0.00% 0
Armor 13865 13865 13775
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 80.66% 65.16% 7815

Gear

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Maguth"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Maguth/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/119/2018167-avatar.jpg"
level=90
race=undead
spec=affliction
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Va!112121
glyphs=soul_swap/siphon_life/soul_shards/eye_of_kilrogg/verdant_spheres/soulwell

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=active_enemies>3
actions+=/summon_doomguard
actions+=/soul_swap,if=buff.soulburn.up
actions+=/haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react&miss_react
actions+=/soul_swap,cycle_targets=1,if=active_enemies>1&time<10&glyph.soul_swap.enabled
actions+=/haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1&miss_react
actions+=/soulburn,line_cd=20,if=buff.dark_soul.up&shard_react
actions+=/soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
actions+=/agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
actions+=/drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
actions+=/life_tap,if=mana.pct<35
actions+=/malefic_grasp,chain=1
actions+=/life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=active_enemies<7
actions.aoe+=/summon_infernal,if=active_enemies>=7
actions.aoe+=/soulburn,cycle_targets=1,if=buff.soulburn.down&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target&shard_react
actions.aoe+=/soul_swap,if=buff.soulburn.up&!dot.agony.ticking&!dot.corruption.ticking
actions.aoe+=/soul_swap,cycle_targets=1,if=buff.soulburn.up&dot.corruption.ticking&!dot.agony.ticking
actions.aoe+=/seed_of_corruption,cycle_targets=1,if=(buff.soulburn.down&!in_flight_to_target&!ticking)|(buff.soulburn.up&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target)
actions.aoe+=/haunt,cycle_targets=1,if=!in_flight_to_target&debuff.haunt.remains<cast_time+travel_time&shard_react
actions.aoe+=/life_tap,if=mana.pct<70
actions.aoe+=/fel_flame,cycle_targets=1,if=!in_flight_to_target

head=xarils_hood_of_intoxicating_vapors,id=86181,gems=burning_primal_160int_180mastery
neck=wire_of_the_wakener,id=89068,reforge=hit_haste
shoulders=mantle_of_the_golden_sun,id=89340,gems=320mastery_60int,enchant=200int_100crit,reforge=crit_mastery
back=mindshard_drape,id=89819,enchant=lightweave_embroidery_3,reforge=crit_haste
chest=imperial_ghostbinders_robes,id=85990,gems=160int_320mastery_120int,enchant=80all,reforge=crit_haste
wrists=minhs_beaten_bracers,id=88893,enchant=180int,reforge=hit_haste
hands=undying_shadow_grips,id=86128,gems=160hit_160mastery_60haste,enchant=170mastery
waist=galaxyfire_girdle,id=89822,gems=320mastery_160int_60crit,reforge=spi_mastery
legs=leggings_of_unleashed_anguish,id=82854,gems=80int_160mastery_60crit,enchant=285int_165crit,reforge=crit_mastery
feet=sandals_of_the_blackest_night,id=86888,gems=320mastery_60mastery,enchant=140mastery
finger1=simple_harmonius_ring,id=89072,enchant=160int,reforge=hit_mastery
finger2=fragment_of_fear_made_flesh,id=86156,enchant=160int,reforge=crit_mastery
trinket1=mithril_wristwatch,id=87572,reforge=crit_mastery
trinket2=light_of_the_cosmos,id=86133,reforge=haste_mastery
main_hand=torch_of_the_celestial_spark,id=86137,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86171,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=16635
# gear_intellect=12419
# gear_spirit=422
# gear_spell_power=6564
# gear_hit_rating=2270
# gear_crit_rating=3535
# gear_haste_rating=4363
# gear_mastery_rating=7815
# gear_armor=13775
# meta_gem=burning_primal
# back=mindshard_drape,enchant=lightweave_embroidery_3
# main_hand=torch_of_the_celestial_spark,enchant=jade_spirit
default_pet=felhunter

Gobarlum

Gobarlum : 87808 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87808.0 87808.0 174.18 / 0.20% 4740 / 5.4% 9339.4 9.4 9.5 Rage 5.82% 55.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Gobarlum/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#ZZ!101221
Glyphs
  • death_from_above
  • unending_rage
  • colossus_smash
  • blazing_trail
  • burning_anger
  • crow_feast
Professions
  • mining: 600
  • blacksmithing: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:138883|79744|75229|34447|34246|24575|11064|9697|6905&chds=0,277766&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++138883++execute,C79C6E,0,0,15|t++79744++dragon_roar,C79C6E,1,0,15|t++75229++raging_blow,C79C6E,2,0,15|t++34447++wild_strike,C79C6E,3,0,15|t++34246++colossus_smash,C79C6E,4,0,15|t++24575++bloodthirst,C79C6E,5,0,15|t++11064++melee_main_hand,C79C6E,6,0,15|t++9697++heroic_throw,C79C6E,7,0,15|t++6905++melee_off_hand,C79C6E,8,0,15&chtt=Gobarlum Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,13,11,9,8,8,7,7,6,6,3,2,2,1,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,62480C,C79C6E&chl=execute|melee_main_hand|raging_blow_mh|bloodthirst|heroic_strike|melee_off_hand|raging_blow_oh|deep_wounds|wild_strike|bloodbath|colossus_smash|dragon_roar|heroic_leap|stormlash|elemental_force_oh|heroic_throw&chtt=Gobarlum Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7674320zzxwwuvrrsnkjihfddcbbaZZYYXYZXXXYYYYYYXXWWWWWWWXWVWWXXYZaabbccccddddcccccabbaZYYYXXXXXWWWXWWVWWWWWWWWVWWWVVWWVVVWWXXXYZaabbcccddddddddcbbbbaZZZYXXXXWWWWWVVWWWWWWWWWWWWWWWWWWWWWWWWWXXYYZaabbccccddccccccbbbaaZZYYXXXWWWWWVVUUVVUUVVVVVWWWWWWWXXXYYYYZaaabbbcccccdccccbbaaaZZYYXXXWWWWWWWWWWWWXXXYYYZZZaaabbbbbccccddeeeffggghhhiiiiiihhhggfffeeddcccbbbaaaaZZZZZZZZaaaaaabbbccddefghjklmnoopqqrsssssrqponmlkjihggfeeddccccccdddeeeefffggghhhhiijjklmnnopqrrstttuuvvuutsrqponmlkkjihhgffefeffffffggggggggggggggggfgggggggghhhiiiiijiijiiihhihhgggfffeefeefeeddddbccbc&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4764,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=87808|max=184300&chxp=1,1,48,100&chtt=Gobarlum DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,1,1,4,2,2,6,11,13,14,17,16,34,27,26,38,35,48,53,59,41,55,52,54,65,52,40,49,35,24,24,20,12,9,8,8,10,6,6,6,2,4,2,2,1,0,1,0,1&chds=0,65&chbh=5&chxt=x&chxl=0:|min=79268|avg=87808|max=97987&chxp=0,1,46,100&chtt=Gobarlum DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.8,21.8,15.3,8.7,7.5,3.8,2.6,1.8,5.8&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 148.0s|raging_blow 98.3s|wild_strike 69.2s|execute 39.4s|colossus_smash 34.0s|heroic_throw 17.0s|dragon_roar 11.7s|battle_shout 8.1s|waiting 26.2s&chtt=Gobarlum Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Gobarlum 87808
battle_shout 0 0.0% 5.2 78.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 5.16 0.00 0.00 1.5736 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by {$s1=10}%. Lasts {$d=300 seconds}. Generates ${{$92049m1=200}/10} Rage.
berserker_rage 0 0.0% 13.2 35.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.24 13.24 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 4966 5.6% 7.5 64.04sec 297241 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.4 17680 0 17680 0.0% 0.0% 28.0%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.52 121.46 126.38 126.38 0.0000 1.0000 2234513.09 2234513.09 0.00 17680.77 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.95 93.81% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.52 6.19% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.4 100.00% 17680.04 1260 65460 17724.38 14008 21342 2234513 2234513 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every {$t1=1} sec. Movement slowed by {$s2=50}%.
  • description:Your target bleeds for an additional {$12292s1=30}% damage of the triggering attack over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:18817.74
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 8070 9.2% 94.1 4.82sec 38670 24575 23525 49453 38668 58.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.08 94.08 0.00 0.00 1.5736 0.0000 3638040.59 3638040.59 0.00 24575.38 24575.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.13 41.59% 23524.73 16519 36094 23548.68 21244 26279 920479 920479 0.00
crit 54.95 58.41% 49453.49 34029 80287 49440.83 45839 52936 2717561 2717561 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
bloodthirst_heal 0 0.0% 94.1 4.82sec 0 0 0 0 0 24.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 94.08 94.08 0.00 0.00 0.0000 0.0000 0.00 147872.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.87 75.33% 0.00 0 0 0.00 0 0 0 88305 100.00
crit 23.21 24.67% 0.00 0 0 0.00 0 0 0 59567 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Gobarlum
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 2583 2.9% 21.6 21.32sec 53890 34246 39880 85108 53889 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 1.5736 0.0000 1163576.15 1163576.15 0.00 34245.99 34245.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.90 69.03% 39880.15 30855 49764 39878.91 34092 44108 594415 594415 0.00
crit 6.69 30.97% 85108.47 63561 102514 85472.92 65402 98826 569161 569161 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for {$s3=2}% weapon damage plus {$s1=222} and weakens their defenses, allowing your attacks to bypass {$s2=100}% of their armor for {$s4=6} sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.{$?s89003=true}[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by {$113746s1=4}% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by {$81326s1=4}% for {$81326d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.5 64.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.48 7.48 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.bloodbath.enabled&rage>=40)|(talent.bloodbath.enabled&buff.bloodbath.up&rage>=40)
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost {$/10;s1=10} less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by {$/10;s1=10} Rage.
deep_wounds 6316 7.2% 94.1 4.82sec 30256 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.9 14450 29972 18991 29.3% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.08 94.08 149.88 149.88 0.0000 3.0000 2846446.43 2846446.43 0.00 6330.47 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.0 70.75% 14450.25 10468 21152 14454.76 13599 15224 1532191 1532191 0.00
crit 43.8 29.25% 29971.67 20936 42304 30000.83 27366 33156 1314256 1314256 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for {$s1=218} every {$t1=3} sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 2065 2.4% 7.4 64.14sec 125466 79744 0 125465 125465 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.41 7.41 0.00 0.00 1.5735 0.0000 930133.45 930133.45 0.00 79743.95 79743.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.41 100.00% 125465.48 83760 170376 125675.11 108933 138932 930133 930133 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar ferociously, causing {$?s12712=false}[${{$m1=126}*1.2}][{$m1=126}] damage to all enemies within $A1 yards, knocking them back and knocking them down for {$118895d=500 milliseconds}. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
elemental_force_oh 831 0.9% 96.7 4.67sec 3878 0 3150 6489 3878 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_force_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.68 96.68 0.00 0.00 0.0000 0.0000 374916.78 374916.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.61 78.20% 3150.00 3150 3150 3150.00 3150 3150 238167 238167 0.00
crit 21.07 21.80% 6489.00 6489 6489 6489.00 6489 6489 136750 136750 0.00
DPS Timeline Chart

Action details: elemental_force_oh

Static Values
  • id:0
  • school:elemental
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3000.00
  • base_dd_max:3000.00
execute 12108 13.8% 25.0 3.42sec 218531 138883 153145 349069 218531 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.02 25.02 0.00 0.00 1.5735 0.0000 5468517.26 5468517.26 0.00 138882.98 138882.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.67 66.63% 153144.80 92660 271920 153123.89 126520 185356 2553572 2553572 0.00
crit 8.35 33.37% 349069.09 190880 560156 351177.00 0 537084 2914946 2914946 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing {$?s12712=false}[${{$m1=1}*1.2}][{$m1=1}] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.000000
  • base_dd_min:8100.94
  • base_dd_max:8100.94
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2054 2.3% 11.0 42.66sec 83763 0 59280 131900 83761 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 11.04 0.00 0.00 0.0000 0.0000 924326.66 924326.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.32 66.29% 59280.11 42673 86864 59259.80 49308 74939 433630 433630 0.00
crit 3.72 33.71% 131899.98 87907 178941 132291.96 0 168357 490697 490697 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*{$52174m1=1}}][{$52174m1=1}] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 7447 8.5% 69.5 5.24sec 48248 0 36493 76950 48245 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.51 69.51 0.00 0.00 0.0000 0.0000 3353789.22 3353789.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.32 70.95% 36492.82 19610 46485 36493.59 33395 39582 1799650 1799650 0.00
crit 20.20 29.05% 76950.35 40396 95760 76990.67 68774 84272 1554140 1554140 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:An attack that instantly deals {$m2=110}% weapon damage plus {$m1=1} (${{$m2=110}*1.40}% plus ${{$m1=1}*1.40} if a one-handed weapon is equipped){$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 365 0.4% 10.8 39.62sec 15256 9697 11863 24467 15255 26.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.5733 0.0000 164559.87 164559.87 0.00 9697.11 9697.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.88 73.08% 11862.94 9048 19966 11866.88 9853 15687 93506 93506 0.00
crit 2.90 26.92% 24467.44 18638 41130 23378.84 0 41130 71054 71054 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:
  • description:Throw your weapon at the enemy, causing {$m1=50}% weapon damage{$?s58357=false}[ and silencing the target for {$18498d=3 seconds}][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
melee_main_hand 11231 12.8% 159.2 2.82sec 31815 11064 30052 62292 31813 26.5% 16.6% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.19 159.19 0.00 0.00 2.8755 0.0000 5064601.87 5064601.87 0.00 11064.19 11064.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.77 33.15% 30051.78 19905 47765 30057.09 27393 33014 1585895 1585895 0.00
crit 42.11 26.46% 62292.21 41004 98396 62293.70 54981 69541 2623469 2623469 0.00
glance 37.86 23.79% 22587.23 14929 35824 22591.47 19598 25318 855238 855238 0.00
miss 26.44 16.61% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 7015 8.0% 159.2 2.82sec 19863 6905 18772 38911 19862 26.5% 16.7% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.18 159.18 0.00 0.00 2.8765 0.0000 3161701.28 3161701.28 0.00 6905.12 6905.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.45 32.95% 18771.53 12441 29853 18775.89 16862 20708 984554 984554 0.00
crit 42.14 26.47% 38911.04 25628 61497 38921.03 35347 43868 1639586 1639586 0.00
glance 38.09 23.93% 14112.78 9330 22390 14121.78 12469 15966 537561 537561 0.00
miss 26.50 16.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (16419) 0.0% (18.7%) 62.5 7.10sec 118377 75229 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.49 62.49 0.00 0.00 1.5736 0.0000 0.00 0.00 0.00 75228.91 75228.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react=2|(buff.raging_blow.react&(target.health.pct<=20|debuff.colossus_smash.up|buff.bloodbath.up|buff.recklessness.up|cooldown.colossus_smash.remains>=6|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=6)))
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$96103m2=190}% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit {$131116s1=2} charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 10092 11.5% 62.5 7.10sec 72763 0 54819 116302 72762 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.49 62.49 0.00 0.00 0.0000 0.0000 4546924.98 4546924.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.25 70.82% 54818.86 33202 78966 54849.05 50480 59065 2425960 2425960 0.00
crit 18.24 29.18% 116302.20 68395 162671 116574.81 97435 132569 2120965 2120965 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$m2=190}% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.90
raging_blow_oh 6327 7.2% 62.5 7.10sec 45614 0 34277 72585 45614 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.49 62.49 0.00 0.00 0.0000 0.0000 2850408.78 2850408.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.00 70.41% 34276.98 20751 49354 34287.08 30859 36819 1508130 1508130 0.00
crit 18.49 29.59% 72585.10 42747 101669 72725.61 62786 83216 1342278 1342278 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$m2=190}% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.90
recklessness 0 0.0% 2.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))&(!talent.bloodbath.enabled|cooldown.bloodbath.remains<=3|((target.time_to_die>315&target.time_to_die<(315+cooldown.bloodbath.remains))|(set_bonus.tier14_4pc_melee&target.time_to_die>165&target.time_to_die<(165+cooldown.bloodbath.remains))))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
stormlash 1047 1.2% 43.3 7.57sec 10728 0 8634 17815 10728 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.30 43.30 0.00 0.00 0.0000 0.0000 464515.67 464515.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.42 77.19% 8633.52 2386 13036 8637.49 7495 9808 288570 288570 0.00
crit 9.88 22.81% 17814.67 4914 26854 17848.49 12203 24107 175946 175946 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8206.00
  • base_dd_max:8206.00
wild_strike 5292 6.0% 54.9 6.34sec 43411 34447 34033 69959 43412 26.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.92 54.92 0.00 0.00 1.2602 0.0000 2384314.06 2384314.06 0.00 34447.44 34447.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.59 73.90% 34033.16 25828 56547 34032.61 30937 37297 1381283 1381283 0.00
crit 14.34 26.10% 69959.19 53205 116488 70011.88 59108 82602 1003031 1003031 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals {$m3=230}% weapon damage plus {$s2=436 + 100.0%} and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:436.20
  • base_dd_max:436.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 13.2 0.0 35.4sec 35.4sec 17.49% 17.49%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:17.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
bloodbath 7.5 0.0 64.0sec 64.0sec 19.75% 23.68%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, causes your melee special attacks to deal an additional {$12292s1=30}% damage as a bleed over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.34%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 15.3 3.6 28.7sec 23.0sec 28.93% 61.94%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • bloodsurge_1:5.01%
  • bloodsurge_2:3.47%
  • bloodsurge_3:20.45%

Trigger Attempt Success

  • trigger_pct:20.09%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:{$@spelldesc46915=Your Bloodthirst hits have a $h% chance of lowering the global cooldown to 1 sec and reducing the Rage cost by $/10;46916s2 of your next 3 Wild Strikes.}
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
dancing_steel 11.9 7.5 37.6sec 22.6sec 40.98% 40.75%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:40.98%

    Trigger Attempt Success

    • trigger_pct:3.55%
deadly_calm 7.5 0.0 64.1sec 64.1sec 7.68% 26.45%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • deadly_calm_1:2.41%
  • deadly_calm_2:2.64%
  • deadly_calm_3:2.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost {$/10;s1=10} less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by {$/10;s1=10} Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:100.00%
enrage 29.2 45.7 15.7sec 6.2sec 77.38% 76.85%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:77.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by {$s2=10}%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:{$@spelldesc13046=Mortal Strike, Bloodthirst and Colossus Smash critical strikes and critical blocks Enrage you, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 40.1 26.8 11.2sec 6.6sec 42.62% 44.71%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:0.00

Stack Uptimes

  • flurry_1:19.97%
  • flurry_2:5.37%
  • flurry_3:17.28%

Trigger Attempt Success

  • trigger_pct:8.94%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by {$s1=25}%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by {$12968s1=25}% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
mogu_power_potion 1.0 0.0 390.5sec 0.0sec 10.06% 10.06%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.06%

    Trigger Attempt Success

    • trigger_pct:100.00%
raging_blow 39.0 35.9 11.0sec 6.2sec 59.98% 59.98%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raging_blow_1:38.85%
  • raging_blow_2:21.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
recklessness 2.0 0.0 389.6sec 0.0sec 5.41% 5.54%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • recklessness_1:5.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.8 0.0 48.2sec 48.2sec 32.08% 32.08%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.08%

    Trigger Attempt Success

    • trigger_pct:18.05%
skullrender_medallion 7.9 0.0 60.9sec 60.9sec 25.89% 25.89%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:skullrender_medallion_trinket1
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3838.00

    Stack Uptimes

    • skullrender_medallion_1:25.89%

    Trigger Attempt Success

    • trigger_pct:100.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Gobarlum
execute Rage 25.0 750.7 30.0 30.0 7284.7
heroic_strike Rage 69.5 1901.8 27.4 27.4 1763.5
raging_blow Rage 62.5 624.8 10.0 10.0 11838.8
wild_strike Rage 54.9 959.7 17.5 17.5 2484.4
Resource Gains Type Count Total Average Overflow
battle_shout Rage 5.16 103.12 (2.42%) 20.00 0.00 0.00%
bloodthirst Rage 94.08 940.72 (22.06%) 10.00 0.05 0.01%
enrage Rage 74.87 745.50 (17.48%) 9.96 3.19 0.43%
melee_main_hand Rage 132.74 1658.59 (38.89%) 12.49 0.67 0.04%
melee_off_hand Rage 132.67 816.84 (19.15%) 6.16 5.71 0.69%
Resource RPS-Gain RPS-Loss
Rage 9.45 9.39
Combat End Resource Mean Min Max
Health 445499.00 445499.00 445499.00
Rage 27.73 0.00 83.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
elemental_force_oh 96.7 4.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Gobarlum Damage Per Second
Count 999
Mean 87807.96
Minimum 79267.76
Maximum 97986.61
Spread ( max - min ) 18718.85
Range [ ( max - min ) / 2 * 100% ] 10.66%
Standard Deviation 2808.9037
5th Percentile 83157.27
95th Percentile 92637.38
( 95th Percentile - 5th Percentile ) 9480.11
Mean Distribution
Standard Deviation 88.8698
95.00% Confidence Intervall ( 87633.78 - 87982.15 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3930
0.1 Scale Factor Error with Delta=300 67353
0.05 Scale Factor Error with Delta=300 269412
0.01 Scale Factor Error with Delta=300 6735306
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 87807.96
Distribution Chart

Damage

Sample Data
Count 999
Mean 39571286.16
Distribution Chart

DTPS

Sample Data Gobarlum Damage Taken Per Second
Count 999
Mean 0.00
Distribution Chart

HPS

Sample Data Gobarlum Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Gobarlum Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 419.46
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 7.91 use_item,name=skullrender_medallion
8 2.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))&(!talent.bloodbath.enabled|cooldown.bloodbath.remains<=3|((target.time_to_die>315&target.time_to_die<(315+cooldown.bloodbath.remains))|(set_bonus.tier14_4pc_melee&target.time_to_die>165&target.time_to_die<(165+cooldown.bloodbath.remains))))|target.time_to_die<=18
9 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
A 7.52 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(debuff.colossus_smash.remains>=5&(target.time_to_die>79|(target.time_to_die<79&target.health.pct<20&(buff.recklessness.up|cooldown.recklessness.remains>=(target.time_to_die-25)))))
B 13.24 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
C 7.48 deadly_calm,use_off_gcd=1,if=(!talent.bloodbath.enabled&rage>=40)|(talent.bloodbath.enabled&buff.bloodbath.up&rage>=40)
D 11.04 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
E 69.51 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
F 94.08 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
G 12.26 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
H 17.32 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1&cooldown.bloodthirst.remains
I 21.59 colossus_smash
J 7.41 dragon_roar,if=talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
K 25.02 execute
L 0.00 storm_bolt,if=talent.storm_bolt.enabled
M 62.48 raging_blow,if=buff.raging_blow.react=2|(buff.raging_blow.react&(target.health.pct<=20|debuff.colossus_smash.up|buff.bloodbath.up|buff.recklessness.up|cooldown.colossus_smash.remains>=6|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=6)))
N 22.11 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
O 0.00 shockwave,if=talent.shockwave.enabled
P 10.79 heroic_throw
Q 4.74 battle_shout,if=rage<70&!debuff.colossus_smash.up
R 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
S 2.27 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
T 0.00 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
U 18.28 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=80&target.health.pct>=20
V 0.41 battle_shout,if=rage<70

Sample Sequence

578BFIADCEMFEMEJFMMFNNGFEMIEFEMPEFNBMGFNHFUQFEIDEMEFENNGFHFP7UBFMIACEFEMEMEFJHFNNGFUHFIDEMEFEMMFMPFEUQFBEUIEFEMMEFHFN7NGFHFIACDEMEFEMEJFBPEMFUHFUIEFENNGFMNGFNNGFBPHFIDEMEFEMEQF7UHFUHFENNGFIACEMEFBEMEJFMNGFNNGFMIDEFEMEMFPHFMUFBUUFIEME7FEMQFMUFNNGFEMIACDEFEMEMEFBJMFMPFEUHFIEMEFEMHFMUFMUFBUIDE7FEMEMFMNGFMNHFPHFEIACEMEFEMEJFMNGFNUHFBMHFEIDEMEFEMPFQUFEU7HFMIEFEMEKFKMFBKKF86KMFIACDKKKFJKFMKFKPFIKKBFKKFK7MFKMFIDKKFKMFKPFBKKFIAK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 18540 16292 15306
Agility 219 209 80
Stamina 21364 19422 18753
Intellect 121 115 80
Spirit 149 149 80
Health 445499 418311 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 17.41% 17.41% 3362
Spell Crit 22.87% 17.87% 10715
Spell Haste 7.06% 1.96% 833
ManaReg per Second 0 0 0
Attack Power 41030 32804 0
Melee Hit 9.89% 9.89% 3362
Melee Crit 27.88% 22.88% 10715
Melee Haste 1.96% 1.96% 833
Swing Speed 12.16% 1.96% 833
Expertise 7.52% / 7.52% 7.52% / 7.52% 2556
Armor 32164 32164 32164
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.03% 5.03% 0
Tank-Parry 21.84% 19.72% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 22.32% 15.32% 1762

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Gobarlum"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Gobarlum/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/243/2440947-avatar.jpg"
level=90
race=tauren
spec=fury
role=attack
position=back
professions=blacksmithing=600/mining=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ZZ!101221
glyphs=death_from_above/unending_rage/colossus_smash/blazing_trail/burning_anger/crow_feast

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/use_item,name=skullrender_medallion
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))&(!talent.bloodbath.enabled|cooldown.bloodbath.remains<=3|((target.time_to_die>315&target.time_to_die<(315+cooldown.bloodbath.remains))|(set_bonus.tier14_4pc_melee&target.time_to_die>165&target.time_to_die<(165+cooldown.bloodbath.remains))))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(debuff.colossus_smash.remains>=5&(target.time_to_die>79|(target.time_to_die<79&target.health.pct<20&(buff.recklessness.up|cooldown.recklessness.remains>=(target.time_to_die-25)))))
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
actions+=/deadly_calm,use_off_gcd=1,if=(!talent.bloodbath.enabled&rage>=40)|(talent.bloodbath.enabled&buff.bloodbath.up&rage>=40)
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1&cooldown.bloodthirst.remains
actions+=/colossus_smash
actions+=/dragon_roar,if=talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react=2|(buff.raging_blow.react&(target.health.pct<=20|debuff.colossus_smash.up|buff.bloodbath.up|buff.recklessness.up|cooldown.colossus_smash.remains>=6|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=6)))
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=80&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=nullification_greathelm,id=86752,gems=reverberating_primal_160crit_160hit_180crit,reforge=haste_hit
neck=necklace_of_congealed_weaknesses,id=86177
shoulders=stonetoe_spaulders,id=89345,gems=320crit_60str,enchant=200str_100crit,reforge=hit_exp
back=cloak_of_peacock_feathers,id=85985,enchant=180hit,reforge=exp_hit
chest=garalons_graven_carapace,id=89832,gems=80str_160crit_320crit_120str,enchant=80all
shirt=tailored_officers_shirt,id=89194
wrists=bonded_soul_bracers,id=89817,gems=320crit,enchant=170mastery,reforge=haste_crit
hands=malevolent_gladiators_plate_gauntlets,id=84840,gems=60str_120hit_160str_60str,enchant=170str
waist=warbelt_of_sealed_pods,id=89826,gems=320crit_320crit_320crit,reforge=exp_hit
legs=legplates_of_resounding_rings,id=85330,gems=80str_160crit_60str,enchant=285str_165crit,reforge=exp_crit
feet=jasper_clawfeet,id=85925,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
finger1=dominators_circle,id=93251,reforge=haste_hit
finger2=ring_of_the_golden_stair,id=89069,reforge=exp_hit
trinket1=skullrender_medallion,id=93256
trinket2=relic_of_xuen,id=79327
main_hand=starshatter,id=86140,enchant=dancing_steel,reforge=exp_hit
off_hand=starshatter,id=86140,enchant=elemental_force,reforge=exp_hit

# Gear Summary
# gear_strength=15306
# gear_agility=80
# gear_stamina=18753
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2556
# gear_hit_rating=3362
# gear_crit_rating=10715
# gear_haste_rating=833
# gear_mastery_rating=1762
# gear_armor=32164
# meta_gem=reverberating_primal
# main_hand=starshatter,weapon=sword2h_3.60speed_12055min_18084max,enchant=dancing_steel
# off_hand=starshatter,weapon=sword2h_3.60speed_12055min_18084max,enchant=elemental_force

Tauranax

Tauranax : 115130 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active Skill
115130.4 115130.4 322.58 / 0.28% 8800 / 7.6% 14528.8 4584.9 4584.9 52.29 / 1.14% 1390 / 30.3% 580.0 7.9 8.0 Rage 0.00% 56.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/Kirin%20Tor/Tauranax/advanced
Talents http://eu.battle.net/wow/en/tool/talent-calculator#Zb!102020
Glyphs
  • hold_the_line
  • bull_rush
  • heavy_repercussions
  • thunder_strike
  • mighty_victory
Professions
  • mining: 600
  • jewelcrafting: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:131367|77033|47796|14494&chds=0,262734&chco=C79C6E,C79C6E,C79C6E,C79C6E&chm=t++131367++shield_slam,C79C6E,0,0,15|t++77033++revenge,C79C6E,1,0,15|t++47796++devastate,C79C6E,2,0,15|t++14494++melee_main_hand,C79C6E,3,0,15&chtt=Tauranax Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:33,19,15,15,13,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=shield_slam|devastate|deep_wounds|revenge|melee_main_hand|stormlash|heroic_strike&chtt=Tauranax Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:hjmmoqprttuvy2258224121z0ywzvuvstrpqnnpmnomnmlnllnllmlmlkmkjmjkljlkkmkkljkkkllkmlkmlmmlmllnllmlmmlmllnllmkllkmkkmklmkllkljjljkljlkjlkjljklkllkmllnlmmlmllmllmllmlmlkmkklkkllnmmpnopoppoqpprpqsrrsqsrprppqpqqoqpoqonomnnlmllnllmlllkmkkmklmkmllmllmkklklkklkkljkkjkjjkjklklllmllmllmllmlmllmllmkllklkklklmmnnnpooqppqpqrqsssutttrsrqrqqrqqqpppnonmnllmlmmlmlklklmlmnmooopppqqqrqsrrsrssqsrqqpppooonoononmnmmmkmllmllmkllklkklkklklmkllkmlllkllklkklkkkjjjjkjjkjklkllklllmllmlmmlmllmlllkllklllmllmlmllmllmllllllklkkkkklkllklkklkllklllmlllkllklkklkklklmlnnnomnoprrstttvvvwv&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6552,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=115130|max=175729&chxp=1,1,66,100&chtt=Tauranax DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,1,1,8,10,4,11,16,17,24,18,25,28,47,50,55,43,51,53,46,61,57,42,51,44,40,27,33,28,14,14,9,17,10,9,4,6,10,4,4,1,0,1,0,0,0,0,0,0,1&chds=0,61&chbh=5&chxt=x&chxl=0:|min=101386|avg=115130|max=136005&chxp=0,1,40,100&chtt=Tauranax DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.3,28.5,22.6,2.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 209.0s|shield_slam 128.8s|revenge 102.1s|battle_shout 12.0s&chtt=Tauranax Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Tauranax 115130
avatar 0 0.0% 3.0 180.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.avatar.enabled
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Physical damage increased by {$s1=20}%.
  • description:You transform into a colossus for {$d=24 seconds}, breaking all roots and snares and increasing your damage dealt by {$s1=20}%.
battle_shout 0 0.0% 7.6 62.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.64 7.64 0.00 0.00 1.5736 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<80
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by {$s1=10}%. Lasts {$d=300 seconds}. Generates ${{$92049m1=200}/10} Rage.
berserker_rage 0 0.0% 15.4 30.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.45 15.45 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
deep_wounds 17698 15.4% 197.8 2.28sec 40350 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.4 49904 100500 53430 7.0% 0.0% 99.3%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.77 197.77 149.35 149.35 0.0000 3.0000 7979981.68 7979981.68 0.00 17810.31 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.9 93.03% 49904.46 7110 99124 49921.72 43461 59862 6933865 6933865 0.00
crit 10.4 6.97% 100500.17 14226 198249 100620.38 73007 143167 1046116 1046116 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for {$s1=218} every {$t1=3} sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
demoralizing_shout 0 0.0% 7.5 63.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.54 7.54 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.
  • description:Demoralizes all enemies within $A1 yards, reducing the damage they do to you by {$s1=20}% for {$d=10 seconds}.
devastate 22152 19.3% 132.9 3.36sec 75203 47796 70277 140979 75202 7.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.86 132.86 0.00 0.00 1.5734 0.0000 9991208.45 9991208.45 0.00 47796.36 47796.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.60 93.03% 70277.30 24625 124524 70299.82 63588 80168 8686323 8686323 0.00
crit 9.26 6.97% 140979.25 49250 249049 141038.49 110242 210290 1304885 1304885 0.00
DPS Timeline Chart

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:Deals {$m1=220}% weapon damage plus ${{$m2=1}*{$m1=220}/100} and sunders the target, causing Weakened Armor. Replaces Sunder Armor. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by {$113746s1=4}% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1657.58
  • base_dd_max:1657.58
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20
heroic_strike 2741 2.4% 24.6 17.92sec 50303 0 46955 93965 50301 7.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.58 24.58 0.00 0.00 0.0000 0.0000 1236525.83 1236525.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.83 92.88% 46954.62 15727 85503 46966.62 38727 55576 1072007 1072007 0.00
crit 1.75 7.12% 93965.42 31455 171006 76649.92 0 160772 164518 164518 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ultimatum.up
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:An attack that instantly deals {$m2=110}% weapon damage plus {$m1=1} (${{$m2=110}*1.40}% plus ${{$m1=1}*1.40} if a one-handed weapon is equipped){$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
last_stand 0 0.0% 4.1 121.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: last_stand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.08 4.08 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: last_stand

Static Values
  • id:12975
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:health<30000
Spelldata
  • id:12975
  • name:Last Stand
  • school:physical
  • tooltip:Maximum health increased by $w1.
  • description:Increases current and maximum health by {$s1=30}% for {$d=20 seconds}.
melee_main_hand 14472 12.6% 201.7 2.23sec 32344 14494 32032 63993 32343 7.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.67 201.67 0.00 0.00 2.2316 0.0000 6522782.58 6522782.58 0.00 14493.59 14493.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.08 68.97% 32031.70 10063 59051 32048.12 28683 37396 4455101 4455101 0.00
crit 14.13 7.01% 63992.89 20129 118102 64032.58 50306 81106 904438 904438 0.00
glance 48.45 24.03% 24007.90 7547 44288 24013.75 21085 29037 1163243 1163243 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revenge 17456 15.2% 64.9 6.97sec 121208 77033 113155 226561 121202 7.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.91 64.91 0.00 0.00 1.5735 0.0000 7867725.38 7867725.38 0.00 77033.36 77033.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.30 92.90% 113154.68 16713 298860 113219.16 94115 132516 6823879 6823879 0.00
crit 4.61 7.10% 226560.56 36818 543382 224156.56 0 441567 1043846 1043846 0.00
DPS Timeline Chart

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage<75
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Instantly attack an enemy and two additional enemies for {$s1=3365 to 4113} damage. A successful dodge or parry will reset the cooldown on Revenge. Generates {$/10;s2=15} Rage in Defensive Stance.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:3365.01
  • base_dd_max:4112.79
shield_barrier 4585 100.0% 8.9 45.03sec 232429 0 148883 0 90745 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_barrier

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 8.91 22.82 0.00 0.00 0.0000 0.0000 2071382.64 2580524.81 19.73 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.91 60.95% 148882.61 403 456008 150088.67 104270 215189 2071383 0 0.00
none 8.91 39.05% 0.00 0 0 0.00 0 0 0 2580525 100.00
HPS Timeline Chart

Action details: shield_barrier

Static Values
  • id:112048
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tauranax
  • harmful:false
  • if_expr:buff.shield_barrier.down&rage>80
Spelldata
  • id:112048
  • name:Shield Barrier
  • school:physical
  • tooltip:Absorbs $w1 damage.
  • description:Raise your shield, absorbing $<absorb> damage for the next {$d=6 seconds}. Consumes up to 60 Rage to increase the amount absorbed. Absorption amount increases with attack power.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:250.00
  • base_dd_max:250.00
shield_block 0 0.0% 50.6 8.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.61 50.61 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 50.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:9.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks.
shield_slam 37521 32.6% 81.8 5.54sec 206703 131367 192814 388073 206703 7.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.84 81.84 0.00 0.00 1.5735 0.0000 16916499.91 16916499.91 0.00 131366.82 131366.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.02 92.89% 192814.46 23312 426014 192855.36 167829 229980 14657368 14657368 0.00
crit 5.82 7.11% 388072.86 51141 852027 388421.32 0 613640 2259131 2259131 0.00
DPS Timeline Chart

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage<75
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slam the target with your shield, causing {$s1=4560 to 4794} damage{$?s58375=false}[ and dispelling 1 magical effect][]. Generates {$/10;s3=20} Rage in Defensive Stance.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:4560.42
  • base_dd_max:4794.29
shield_wall 0 0.0% 3.6 132.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_wall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 3.62 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shield_wall

Static Values
  • id:871
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shield_block.down
Spelldata
  • id:871
  • name:Shield Wall
  • school:physical
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage taken by {$s1=40}% for {$d=12 seconds}.
stormlash 3091 2.6% 43.7 7.50sec 31398 0 30728 62321 31406 2.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.67 43.67 0.00 0.00 0.0000 0.0000 1371255.80 1371255.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.73 97.85% 30727.76 2301 75587 30718.02 21499 44531 1312741 1312741 0.00
crit 0.94 2.15% 62320.55 4607 151175 38738.63 0 151175 58515 58515 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:12908.02
  • base_dd_max:12908.02

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
avatar 3.0 0.0 180.9sec 180.9sec 15.62% 17.37%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avatar_1:15.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Physical damage increased by {$s1=20}%.
  • description:You transform into a colossus for {$d=24 seconds}, breaking all roots and snares and increasing your damage dealt by {$s1=20}%.
  • max_stacks:
  • duration:24.00
  • cooldown:180.00
  • default_chance:0.00%
berserker_rage 15.4 0.0 30.1sec 30.1sec 20.43% 20.43%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:20.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.96%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
enrage 30.4 21.1 15.0sec 8.8sec 57.02% 57.07%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:57.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by {$s2=10}%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:{$@spelldesc13046=Mortal Strike, Bloodthirst and Colossus Smash critical strikes and critical blocks Enrage you, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
hold_the_line 21.0 3.3 20.8sec 17.9sec 24.94% 39.17%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_hold_the_line
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • hold_the_line_1:24.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84619
  • name:Hold the Line
  • tooltip:Improves the damage of your next Revenge.
  • description:Improves the damages of Revenge by {$84619s1=50}% following a successful parry.
  • max_stacks:
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
laochins_liquid_courage 7.8 0.0 61.4sec 61.4sec 25.69% 25.69%

Buff details

  • buff initial source:Tauranax
  • cooldown name:laochins_liquid_courage_trinket1
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:2822.00

    Stack Uptimes

    • laochins_liquid_courage_1:25.69%

    Trigger Attempt Success

    • trigger_pct:100.00%
last_stand 2.2 0.0 242.3sec 242.3sec 9.71% 9.71%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_last_stand
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • last_stand_1:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12975
  • name:Last Stand
  • tooltip:Maximum health increased by $w1.
  • description:Increases current and maximum health by {$s1=30}% for {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
medallion_of_mystifying_vapors 7.6 0.0 61.4sec 61.4sec 24.80% 24.80%

Buff details

  • buff initial source:Tauranax
  • cooldown name:medallion_of_mystifying_vapors_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:3838.00

    Stack Uptimes

    • medallion_of_mystifying_vapors_1:24.80%

    Trigger Attempt Success

    • trigger_pct:100.00%
shield_barrier 8.9 0.0 45.0sec 45.0sec 9.11% 60.65%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_shield_barrier
  • max_stacks:1
  • duration:6.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shield_barrier_1:9.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112048
  • name:Shield Barrier
  • tooltip:Absorbs $w1 damage.
  • description:Raise your shield, absorbing $<absorb> damage for the next {$d=6 seconds}. Consumes up to 60 Rage to increase the amount absorbed. Absorption amount increases with attack power.
  • max_stacks:
  • duration:6.00
  • cooldown:1.50
  • default_chance:0.00%
shield_block 45.9 0.0 9.8sec 9.8sec 66.84% 55.96%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shield_block_1:66.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
shield_wall 3.6 0.0 132.0sec 132.0sec 9.53% 17.48%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_shield_wall
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.40

Stack Uptimes

  • shield_wall_1:9.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:871
  • name:Shield Wall
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage taken by {$s1=40}% for {$d=12 seconds}.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
sword_and_board 39.7 0.3 11.1sec 11.0sec 14.18% 48.25%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:14.18%

Trigger Attempt Success

  • trigger_pct:30.16%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a {$s1=50}% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for {$50227d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
ultimatum 24.6 0.0 17.9sec 17.9sec 0.00% 0.00%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:30.03%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike or Cleave costs no Rage.
  • description:Your Shield Slam has a $122509h% chance to make your next Heroic Strike or Cleave cost no Rage.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
vengeance 1.0 180.4 0.0sec 2.5sec 99.98% 99.83%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_vengeance
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vengeance_1:99.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Tauranax
shield_barrier Rage 8.9 534.8 60.0 60.0 3873.3
shield_block Rage 50.6 3036.5 60.0 60.0 0.0
Resource Gains Type Count Total Average Overflow
battle_shout Rage 7.64 152.84 (4.22%) 20.00 0.00 0.00%
critical_block Rage 36.08 359.14 (9.91%) 9.95 1.62 0.45%
defensive_stance Rage 1803.90 150.05 (4.14%) 0.08 0.28 0.18%
enrage Rage 15.45 153.15 (4.23%) 9.91 1.33 0.86%
revenge Rage 64.91 973.66 (26.87%) 15.00 0.00 0.00%
shield_slam Rage 81.84 1834.44 (50.63%) 22.41 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 6652.28 42939.19
Rage 8.03 7.92
Combat End Resource Mean Min Max
Health -15796961.19 -22266864.68 -9127882.73
Rage 51.99 0.42 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.2%

Procs

Count Interval
parry_haste 18.6 23.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Tauranax Damage Per Second
Count 999
Mean 115130.35
Minimum 101385.96
Maximum 136004.80
Spread ( max - min ) 34618.83
Range [ ( max - min ) / 2 * 100% ] 15.03%
Standard Deviation 5202.0261
5th Percentile 106607.23
95th Percentile 124206.99
( 95th Percentile - 5th Percentile ) 17599.76
Mean Distribution
Standard Deviation 164.5848
95.00% Confidence Intervall ( 114807.77 - 115452.93 )
Normalized 95.00% Confidence Intervall ( 99.72% - 100.28% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7842
0.1 Scale Factor Error with Delta=300 231008
0.05 Scale Factor Error with Delta=300 924035
0.01 Scale Factor Error with Delta=300 23100890
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 115130.35
Distribution Chart

Damage

Sample Data
Count 999
Mean 51885979.63
Distribution Chart

DTPS

Sample Data Tauranax Damage Taken Per Second
Count 999
Mean 42941.73
Distribution Chart

HPS

Sample Data Tauranax Healing Per Second
Count 999
Mean 4584.89
Minimum 1706.52
Maximum 7116.22
Spread ( max - min ) 5409.70
Range [ ( max - min ) / 2 * 100% ] 58.99%
Standard Deviation 843.2027
5th Percentile 3219.23
95th Percentile 5999.76
( 95th Percentile - 5th Percentile ) 2780.53
Mean Distribution
Standard Deviation 26.6778
95.00% Confidence Intervall ( 4532.60 - 4637.18 )
Normalized 95.00% Confidence Intervall ( 98.86% - 101.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1299
0.1% Error 129927
0.1 Scale Factor Error with Delta=300 6069
0.05 Scale Factor Error with Delta=300 24277
0.01 Scale Factor Error with Delta=300 606942
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 4584.89
Distribution Chart

Heal

Sample Data
Count 999
Mean 2071382.64
Distribution Chart

HTPS

Sample Data Tauranax Healing taken Per Second
Count 999
Mean 4811.18
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 422.47
Distribution Chart
Vengeance Timeline Chart Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=earth
1 0.00 food,type=great_pandaren_banquet
2 0.00 snapshot_stats
3 0.00 stance,choose=defensive
4 0.00 mountains_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mountains_potion,if=health.pct<35&buff.mountains_potion.down
7 7.84 use_item,name=laochins_liquid_courage
8 7.58 use_item,name=medallion_of_mystifying_vapors
9 4.08 last_stand,if=health<30000
A 3.01 avatar,if=talent.avatar.enabled
B 24.59 heroic_strike,if=buff.ultimatum.up,use_off_gcd=1
C 15.45 berserker_rage,use_off_gcd=1
D 81.84 shield_slam,if=rage<75
E 64.91 revenge,if=rage<75
F 7.64 battle_shout,if=rage<80
G 50.61 shield_block
H 8.91 shield_barrier,if=buff.shield_barrier.down&rage>80
I 0.00 thunder_clap,if=target.debuff.weakened_blows.down
J 3.62 shield_wall,if=buff.shield_block.down
K 7.54 demoralizing_shout
L 132.85 devastate

Sample Sequence

57ACDEEFGDKLLDBGEE8EDGLELD9GLDLECHJLDLLLDEGLEDGLLEDLL6LDGEC7EEGDFLKLDBGELE8DBGLLDELLDGLCEEHDELDGELEDGELDLDBGLELDBCHL7ELDFGEKLDBGLLD8ELDGEL9EDBHLCLEDBGELDGLDLELDBGLDLDHEJLLCADGL7LEDBFGLKLDEGLL8DEELDBGLLLCDEGLDLELDGELLDLDBGEELDBGECLE7DHELFGDKLLDEGL8LDLE9GLDBLCLLDEGLLDLLEGDBLELDGELLDCHJLLD7EGLLDBEFGKLDLDB8GELDEHLECDGLLLDEGLLDBELGLDLLEDGLDBCAEEHLD7LLDBGELDEFGED8KLGLL9DECLEGDBLLLDGELLDLDBGEEELLLGDCELLJL7GDEEHLDLGLFDE8KLDBGLLDBCEHL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 10231 9744 9533
Agility 135 129 0
Stamina 32464 27701 22273
Intellect 37 35 0
Spirit 69 69 0
Health 600899 534217 0
Rage 100 100 0
Spell Power 0 0 0
Spell Hit 18.09% 18.09% 2559
Spell Crit 5.00% 0.00% 0
Spell Haste 5.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 22750 19708 0
Melee Hit 7.53% 7.53% 2559
Melee Crit 10.01% 5.01% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 10.00% 0.00% 0
Expertise 10.57% 10.57% 3593
Armor 62592 62592 49285
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.99% 12.71% 5133
Tank-Parry 16.48% 16.00% 2527
Tank-Block 22.44% 20.10% 0
Tank-Crit 0.00% 0.00% 0
Mastery 42.35% 31.35% 3751

Gear

Source Slot Average Item Level: 488.75
Local Head yis_least_favorite_helmet,id=89216,gems=austere_primal_480sta_270sta,reforge=dodge_hit
Local Neck beads_of_the_mogushi,id=85922,reforge=dodge_hit
Local Shoulders shoulders_of_autumnlight,id=89346,gems=160hit_120sta_90sta,enchant=300sta_100dodge,reforge=dodge_parry
Local Shirt brawlers_harness,id=6125
Local Chest cuirass_of_the_animated_protector,id=86891,gems=160exp_120sta_160mastery_120sta_120str,enchant=300sta,reforge=dodge_exp
Local Waist klaxxi_lash_of_the_consumer,id=89056,gems=240sta_480sta_60parry,reforge=parry_exp
Local Legs legguards_of_resounding_rings,id=86665,gems=160exp_120sta_90sta,enchant=430sta_165dodge,reforge=dodge_exp
Local Feet sollerets_of_spirit_splitting,id=85992,gems=160hit_120sta_60dodge,enchant=140mastery,reforge=dodge_exp
Local Wrists bracers_of_six_oxen,id=85983,enchant=170dodge,reforge=dodge_exp
Local Hands handguards_of_resounding_rings,id=85327,enchant=170exp,reforge=dodge_exp
Local Finger1 seal_of_the_unscathed,id=90860,reforge=dodge_hit
Local Finger2 alanis_inflexible_ring,id=89071,reforge=dodge_exp
Local Trinket1 laochins_liquid_courage,id=89079
Local Trinket2 medallion_of_mystifying_vapors,id=93257,reforge=dodge_exp
Local Back yis_cloak_of_courage,id=89075,enchant=200sta,reforge=parry_hit
Local Main Hand scimitar_of_seven_stars,id=86863,gems=240sta_60mastery,enchant=colossus,reforge=mastery_exp
Local Off Hand steelskin_qiangs_impervious_shield,id=86075,enchant=170parry,reforge=dodge_hit
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Tauranax"
origin="http://eu.battle.net/wow/en/character/Kirin%20Tor/Tauranax/advanced"
thumbnail="http://eu.battle.net/static-render/eu/kirin-tor/205/42147021-avatar.jpg"
level=90
race=tauren
spec=protection
role=tank
position=front
professions=jewelcrafting=600/mining=600
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!102020
glyphs=hold_the_line/bull_rush/heavy_repercussions/thunder_strike/mighty_victory

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=flask,type=earth
actions.precombat+=/food,type=great_pandaren_banquet
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=defensive
actions.precombat+=/mountains_potion

actions=auto_attack
actions+=/mountains_potion,if=health.pct<35&buff.mountains_potion.down
actions+=/use_item,name=laochins_liquid_courage
actions+=/use_item,name=medallion_of_mystifying_vapors
actions+=/last_stand,if=health<30000
actions+=/avatar,if=talent.avatar.enabled
actions+=/heroic_strike,if=buff.ultimatum.up,use_off_gcd=1
actions+=/berserker_rage,use_off_gcd=1
actions+=/shield_slam,if=rage<75
actions+=/revenge,if=rage<75
actions+=/battle_shout,if=rage<80
actions+=/shield_block
actions+=/shield_barrier,if=buff.shield_barrier.down&rage>80
actions+=/thunder_clap,if=target.debuff.weakened_blows.down
actions+=/shield_wall,if=buff.shield_block.down
actions+=/demoralizing_shout
actions+=/devastate

head=yis_least_favorite_helmet,id=89216,gems=austere_primal_480sta_270sta,reforge=dodge_hit
neck=beads_of_the_mogushi,id=85922,reforge=dodge_hit
shoulders=shoulders_of_autumnlight,id=89346,gems=160hit_120sta_90sta,enchant=300sta_100dodge,reforge=dodge_parry
back=yis_cloak_of_courage,id=89075,enchant=200sta,reforge=parry_hit
chest=cuirass_of_the_animated_protector,id=86891,gems=160exp_120sta_160mastery_120sta_120str,enchant=300sta,reforge=dodge_exp
shirt=brawlers_harness,id=6125
wrists=bracers_of_six_oxen,id=85983,enchant=170dodge,reforge=dodge_exp
hands=handguards_of_resounding_rings,id=85327,enchant=170exp,reforge=dodge_exp
waist=klaxxi_lash_of_the_consumer,id=89056,gems=240sta_480sta_60parry,reforge=parry_exp
legs=legguards_of_resounding_rings,id=86665,gems=160exp_120sta_90sta,enchant=430sta_165dodge,reforge=dodge_exp
feet=sollerets_of_spirit_splitting,id=85992,gems=160hit_120sta_60dodge,enchant=140mastery,reforge=dodge_exp
finger1=seal_of_the_unscathed,id=90860,reforge=dodge_hit
finger2=alanis_inflexible_ring,id=89071,reforge=dodge_exp
trinket1=laochins_liquid_courage,id=89079
trinket2=medallion_of_mystifying_vapors,id=93257,reforge=dodge_exp
main_hand=scimitar_of_seven_stars,id=86863,gems=240sta_60mastery,enchant=colossus,reforge=mastery_exp
off_hand=steelskin_qiangs_impervious_shield,id=86075,enchant=170parry,reforge=dodge_hit

# Gear Summary
# gear_strength=9533
# gear_stamina=22273
# gear_expertise_rating=3593
# gear_hit_rating=2559
# gear_mastery_rating=3751
# gear_armor=49285
# gear_dodge_rating=5133
# gear_parry_rating=2527
# meta_gem=austere_primal
# tier14_2pc_tank=1
# main_hand=scimitar_of_seven_stars,weapon=sword_2.60speed_5343min_9923max

Simulation & Raid Information

Iterations: 1000
Threads: 1
Confidence: 95.00%
Fight Length: 349 - 557 ( 451.1 )

Performance:

Total Events Processed: 56848148
Max Event Queue: 360
Sim Seconds: 451099
CPU Seconds: 174.2200
Speed Up: 2589

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 74 ms ( stddev = 18 ms )

Simulation Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Standard Deviation 57.3182
5th Percentile 365.63
95th Percentile 541.60
( 95th Percentile - 5th Percentile ) 175.97
Mean Distribution
Standard Deviation 1.8135
95.00% Confidence Intervall ( 447.55 - 454.65 )
Normalized 95.00% Confidence Intervall ( 99.21% - 100.79% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 620
0.1% Error 62020
0.1 Scale Factor Error with Delta=300 28
0.05 Scale Factor Error with Delta=300 112
0.01 Scale Factor Error with Delta=300 2804
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Natadu Natadu moonfire 8921 386277 856 3.62 12325 26918 27.2 27.2 12.9% 0.0% 0.0% 0.0% 16.73sec 3506641 451.10sec
Natadu Natadu moonfire ticks -8921 3120364 6934 33.68 10796 22469 27.2 252.6 13.3% 0.0% 0.0% 0.0% 16.73sec 3506641 451.10sec
Natadu Natadu starfall ticks -48505 3171313 7047 20.21 18266 37931 15.3 151.6 13.5% 0.0% 0.0% 0.0% 31.70sec 3171313 451.10sec
Natadu Natadu starfire 2912 9058789 20082 11.80 89013 186280 88.7 88.7 13.5% 0.0% 0.0% 0.0% 4.97sec 9058789 451.10sec
Natadu Natadu starsurge 78674 4287758 9505 4.73 105809 218833 35.6 35.5 13.2% 0.0% 0.0% 0.0% 12.71sec 4287758 451.10sec
Natadu Natadu stormlash 120687 580760 1287 2.92 23015 48296 21.9 21.9 13.8% 0.0% 0.0% 0.0% 15.23sec 580760 451.10sec
Natadu Natadu sunfire 93402 331899 736 3.66 10339 25265 27.5 27.5 11.6% 0.0% 0.0% 0.0% 16.49sec 3423780 451.10sec
Natadu Natadu sunfire ticks -93402 3091881 6871 33.73 10690 22239 27.5 253.0 13.3% 0.0% 0.0% 0.0% 16.49sec 3423780 451.10sec
Natadu Natadu wild_mushroom_detonate 88751 96743 214 0.53 20632 43649 1.0 4.0 15.4% 0.0% 0.0% 0.0% nansec 96743 451.10sec
Natadu Natadu wrath 5176 5037460 11167 12.19 48225 99266 91.9 91.6 13.2% 0.0% 0.0% 0.0% 4.43sec 5037460 451.10sec
Ellimac Ellimac berserk 106952 0 0 0.39 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 184.81sec 0 451.10sec
Ellimac Ellimac cat_melee 0 8493575 18829 70.01 12417 25847 526.4 526.4 34.0% 1.0% 23.9% 0.0% 0.86sec 8493575 451.10sec
Ellimac Ellimac elemental_force 0 310246 688 11.74 3150 6489 88.3 88.3 11.8% 0.9% 0.0% 0.0% 5.11sec 310246 451.10sec
Ellimac Ellimac ferocious_bite 22568 2488356 5516 2.59 77798 163896 19.5 19.5 58.8% 0.9% 0.0% 0.0% 23.54sec 2488356 451.10sec
Ellimac Ellimac rake ticks -1822 8022394 17828 23.90 32695 68330 30.4 179.2 33.9% 0.0% 0.0% 0.0% 14.89sec 8022394 451.10sec
Ellimac Ellimac rip ticks -1079 8138894 18086 26.14 30300 63324 12.7 196.0 34.0% 0.0% 0.0% 0.0% 28.52sec 8138894 451.10sec
Ellimac Ellimac savage_roar 52610 0 0 2.08 0 0 15.6 15.6 0.0% 0.0% 0.0% 0.0% 29.37sec 0 451.10sec
Ellimac Ellimac shred 5221 6882569 15257 17.40 38777 80575 130.8 130.8 34.0% 1.0% 0.0% 0.0% 3.45sec 6882569 451.10sec
Ellimac Ellimac skull_bash 106839 0 0 0.16 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Ellimac Ellimac stormlash 120687 307966 683 8.70 4223 8638 65.4 65.4 11.9% 0.9% 0.0% 0.0% 4.97sec 307966 451.10sec
Ellimac Ellimac thrash_cat 106830 112627 250 1.11 9956 20812 8.3 8.3 33.7% 0.9% 0.0% 0.0% 49.52sec 750347 451.10sec
Ellimac Ellimac thrash_cat ticks -106830 637720 1417 5.34 11611 24305 8.3 40.1 34.0% 0.0% 0.0% 0.0% 49.52sec 750347 451.10sec
Ellimac Ellimac tigers_fury 5217 0 0 2.00 0 0 15.0 15.0 0.0% 0.0% 0.0% 0.0% 30.81sec 0 451.10sec
Xabiss Xabiss arcane_shot 3044 2815514 6241 10.29 28961 60263 77.5 77.3 24.0% 0.2% 0.0% 0.0% 5.68sec 2815514 451.10sec
Xabiss Xabiss auto_shot 75 4856275 10765 28.31 18113 37715 213.2 212.9 24.2% 0.2% 0.0% 0.0% 2.11sec 4856275 451.10sec
Xabiss Xabiss berserking 26297 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 451.10sec
Xabiss Xabiss bestial_wrath 19574 0 0 1.19 0 0 9.0 9.0 0.0% 0.0% 0.0% 0.0% 52.76sec 0 451.10sec
Xabiss Xabiss blink_strike 130392 0 0 2.97 0 0 22.3 22.3 0.0% 0.0% 0.0% 0.0% 20.43sec 0 451.10sec
Xabiss Xabiss_cat blink_strike 130393 2177852 4828 2.97 74617 152599 22.3 22.3 34.9% 0.2% 23.8% 0.0% 20.43sec 2177852 451.10sec
Xabiss Xabiss cobra_shot 77767 2464429 5463 14.53 17944 37356 109.4 109.2 23.9% 0.2% 0.0% 0.0% 4.01sec 2464429 451.10sec
Xabiss Xabiss dire_beast 120679 0 0 1.83 0 0 13.8 13.8 0.0% 0.0% 0.0% 0.0% 32.30sec 0 451.10sec
Xabiss Xabiss_dire_beast dire_beast_melee 0 2584081 12866 37.69 17285 35125 126.2 126.2 23.9% 0.2% 24.1% 0.0% 3.37sec 2584081 200.84sec
Xabiss Xabiss focus_fire 82692 0 0 1.24 0 0 9.3 9.3 0.0% 0.0% 0.0% 0.0% 45.99sec 0 451.10sec
Xabiss Xabiss glaive_toss 117050 2510431 5565 7.58 34808 73101 28.6 57.0 24.4% 0.2% 0.0% 0.0% 15.92sec 2510431 451.10sec
Xabiss Xabiss kill_command 34026 0 0 8.80 0 0 66.2 66.2 0.0% 0.0% 0.0% 0.0% 6.83sec 0 451.10sec
Xabiss Xabiss_cat kill_command 83381 5229011 11592 8.80 58576 118728 66.2 66.2 34.2% 0.2% 0.0% 0.0% 6.83sec 5229011 451.10sec
Xabiss Xabiss kill_shot 53351 1425392 3160 2.01 74674 155352 15.2 15.1 24.7% 0.3% 0.0% 0.0% 5.62sec 1425392 451.10sec
Xabiss Xabiss rapid_fire 3045 0 0 0.62 0 0 4.6 4.6 0.0% 0.0% 0.0% 0.0% 100.48sec 0 451.10sec
Xabiss Xabiss readiness 23989 0 0 0.25 0 0 1.9 1.9 0.0% 0.0% 0.0% 0.0% 376.08sec 0 451.10sec
Xabiss Xabiss serpent_sting ticks -1978 2230259 4956 17.92 13112 27426 27.8 134.4 24.3% 0.0% 0.0% 0.0% 16.52sec 2230259 451.10sec
Xabiss Xabiss stampede 121818 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 372.51sec 0 451.10sec
Xabiss Xabiss_devilsaur stormlash 120687 21658 543 38.08 657 1338 25.3 25.3 29.4% 0.2% 0.0% 0.0% 0.59sec 21658 39.85sec
Xabiss Xabiss_devilsaur melee 0 230089 5773 76.49 3393 6998 50.8 50.8 37.1% 0.2% 24.2% 0.0% 7.84sec 230089 39.85sec
Xabiss Xabiss_devilsaur rabid 53401 0 0 3.01 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 372.59sec 0 39.85sec
Xabiss Xabiss_devilsaur monstrous_bite 54680 0 0 11.98 0 0 8.0 8.0 37.0% 0.2% 0.0% 0.0% 56.11sec 0 39.85sec
Xabiss Xabiss_devilsaur claw 16827 130336 3270 20.72 6894 14052 13.8 13.8 36.1% 0.1% 0.0% 0.0% 30.70sec 130336 39.85sec
Xabiss Xabiss_raptor stormlash 120687 21519 540 38.11 659 1306 25.3 25.3 29.8% 0.2% 0.0% 0.0% 0.59sec 21519 39.85sec
Xabiss Xabiss_raptor melee 0 230508 5784 76.56 3396 6998 50.8 50.8 37.2% 0.2% 24.3% 0.0% 7.84sec 230508 39.85sec
Xabiss Xabiss_raptor rabid 53401 0 0 3.01 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 372.59sec 0 39.85sec
Xabiss Xabiss_raptor claw 16827 130913 3285 20.71 6832 14279 13.8 13.8 36.2% 0.2% 0.0% 0.0% 30.71sec 130913 39.85sec
Xabiss Xabiss_hyena stormlash 120687 21510 540 38.04 659 1326 25.3 25.3 29.1% 0.2% 0.0% 0.0% 0.59sec 21510 39.85sec
Xabiss Xabiss_hyena melee 0 231025 5797 76.51 3393 7004 50.8 50.8 37.5% 0.2% 23.7% 0.0% 7.84sec 231025 39.85sec
Xabiss Xabiss_hyena rabid 53401 0 0 3.01 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 372.59sec 0 39.85sec
Xabiss Xabiss_hyena cackling_howl 128432 0 0 3.01 0 0 2.0 2.0 0.0% 0.1% 0.0% 0.0% 372.59sec 0 39.85sec
Xabiss Xabiss_hyena claw 16827 130641 3278 20.71 6874 14111 13.8 13.8 36.4% 0.2% 0.0% 0.0% 30.71sec 130641 39.85sec
Xabiss Xabiss_wolf stormlash 120687 21640 543 38.10 661 1317 25.3 25.3 29.8% 0.2% 0.0% 0.0% 0.59sec 21640 39.85sec
Xabiss Xabiss_wolf melee 0 231080 5798 76.64 3395 7003 50.9 50.9 37.4% 0.2% 24.2% 0.0% 7.83sec 231080 39.85sec
Xabiss Xabiss_wolf rabid 53401 0 0 3.01 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 372.59sec 0 39.85sec
Xabiss Xabiss_wolf claw 16827 130631 3278 20.71 6860 14178 13.8 13.8 36.2% 0.2% 0.0% 0.0% 30.72sec 130631 39.85sec
Xabiss Xabiss stormlash 120687 489766 1086 5.64 10575 21536 42.4 42.4 9.1% 0.2% 0.0% 0.0% 7.71sec 489766 451.10sec
Xabiss Xabiss_cat claw 16827 3696506 8194 16.99 19702 39846 127.8 127.8 46.0% 0.2% 0.0% 0.0% 3.55sec 3696506 451.10sec
Xabiss Xabiss_cat melee 0 5612296 12441 47.04 12200 24948 353.7 353.7 34.6% 0.2% 24.0% 0.0% 1.27sec 5612296 451.10sec
Xabiss Xabiss_cat rabid 53401 0 0 0.78 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 84.64sec 0 451.10sec
Xabiss Xabiss_cat stormlash 120687 166156 368 6.61 2604 5344 49.7 49.7 27.3% 0.2% 0.0% 0.0% 6.58sec 166156 451.10sec
Khorelle Khorelle a_murder_of_crows ticks -131894 1305163 2900 20.24 7254 14974 5.3 151.8 23.6% 0.0% 0.0% 0.0% 112.77sec 1305163 451.10sec
Khorelle Khorelle arcane_shot 3044 2773005 6147 11.34 26425 53315 85.3 85.2 22.7% 0.0% 0.0% 0.0% 5.16sec 2773005 451.10sec
Khorelle Khorelle arcane_torrent 80483 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.75sec 0 451.10sec
Khorelle Khorelle auto_shot 75 3266948 7242 24.75 14186 28766 186.3 186.1 23.1% 0.0% 0.0% 0.0% 2.41sec 3266948 451.10sec
Khorelle Khorelle black_arrow ticks -3674 1842364 4094 23.07 8559 17590 17.5 173.0 23.1% 0.0% 0.0% 0.0% 25.59sec 1842364 451.10sec
Khorelle Khorelle cobra_shot 77767 1711224 3793 11.15 16486 33448 84.0 83.8 23.2% 0.0% 0.0% 0.0% 5.26sec 1711224 451.10sec
Khorelle Khorelle explosive_shot 53301 2060811 4568 13.95 15829 32393 105.1 104.9 23.1% 0.0% 0.0% 0.0% 4.26sec 6154234 451.10sec
Khorelle Khorelle explosive_shot ticks -53301 4093423 9096 25.72 17137 34988 105.1 192.9 22.9% 0.0% 0.0% 0.0% 4.26sec 6154234 451.10sec
Khorelle Khorelle glaive_toss 117050 2069814 4588 7.84 28244 57907 29.6 59.0 23.1% 0.0% 0.0% 0.0% 15.46sec 2069814 451.10sec
Khorelle Khorelle kill_shot 53351 973638 2158 1.78 58589 118851 13.5 13.4 23.3% 0.0% 0.0% 0.0% 6.26sec 973638 451.10sec
Khorelle Khorelle lifeblood 0 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.75sec 0 451.10sec
Khorelle Khorelle multi_shot 2643 36132 80 0.48 8200 16595 3.6 3.6 22.2% 0.0% 0.0% 0.0% 80.82sec 36132 451.10sec
Khorelle Khorelle rapid_fire 3045 0 0 0.60 0 0 4.5 4.5 0.0% 0.0% 0.0% 0.0% 102.86sec 0 451.10sec
Khorelle Khorelle readiness 23989 0 0 0.24 0 0 1.8 1.8 0.0% 0.0% 0.0% 0.0% 383.36sec 0 451.10sec
Khorelle Khorelle serpent_sting ticks -1978 3193777 7097 17.70 19432 39511 28.5 132.7 23.1% 0.0% 0.0% 0.0% 15.82sec 3193777 451.10sec
Khorelle Khorelle improved_serpent_sting 82834 659891 1463 3.79 18655 37960 28.5 28.5 23.4% 0.0% 0.0% 0.0% 15.81sec 659891 451.10sec
Khorelle Khorelle stampede 121818 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.36sec 0 451.10sec
Khorelle Khorelle_devilsaur stormlash 120687 11802 302 38.62 363 748 25.2 25.2 27.4% 0.0% 0.0% 0.0% 0.65sec 11802 39.12sec
Khorelle Khorelle_devilsaur melee 0 123501 3157 70.78 2011 4181 46.1 46.1 35.8% 0.0% 23.9% 0.0% 8.71sec 123501 39.12sec
Khorelle Khorelle_devilsaur rabid 53401 0 0 3.07 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.43sec 0 39.12sec
Khorelle Khorelle_devilsaur monstrous_bite 54680 0 0 9.02 0 0 5.9 5.9 35.1% 0.0% 0.0% 0.0% 80.59sec 0 39.12sec
Khorelle Khorelle_devilsaur claw 16827 69198 1769 20.61 3702 7763 13.4 13.4 35.6% 0.0% 0.0% 0.0% 31.73sec 69198 39.12sec
Khorelle Khorelle_raptor stormlash 120687 11749 300 38.62 364 746 25.2 25.2 27.0% 0.0% 0.0% 0.0% 0.65sec 11749 39.12sec
Khorelle Khorelle_raptor melee 0 123585 3159 70.78 2007 4199 46.1 46.1 35.8% 0.0% 24.2% 0.0% 8.71sec 123585 39.12sec
Khorelle Khorelle_raptor rabid 53401 0 0 3.07 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.43sec 0 39.12sec
Khorelle Khorelle_raptor claw 16827 69794 1784 20.61 3661 7904 13.4 13.4 36.1% 0.0% 0.0% 0.0% 31.73sec 69794 39.12sec
Khorelle Khorelle_hyena stormlash 120687 11818 302 38.62 364 743 25.2 25.2 27.7% 0.0% 0.0% 0.0% 0.65sec 11818 39.12sec
Khorelle Khorelle_hyena melee 0 123673 3162 70.78 2003 4205 46.1 46.1 35.8% 0.0% 23.9% 0.0% 8.72sec 123673 39.12sec
Khorelle Khorelle_hyena rabid 53401 0 0 3.07 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.43sec 0 39.12sec
Khorelle Khorelle_hyena cackling_howl 128432 0 0 3.07 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.43sec 0 39.12sec
Khorelle Khorelle_hyena claw 16827 69275 1771 20.62 3678 7850 13.4 13.4 35.4% 0.0% 0.0% 0.0% 31.73sec 69275 39.12sec
Khorelle Khorelle_wolf stormlash 120687 11795 302 38.61 362 752 25.2 25.2 27.2% 0.0% 0.0% 0.0% 0.65sec 11795 39.12sec
Khorelle Khorelle_wolf melee 0 123755 3164 70.78 2008 4197 46.1 46.1 35.9% 0.0% 23.9% 0.0% 8.71sec 123755 39.12sec
Khorelle Khorelle_wolf rabid 53401 0 0 3.07 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 376.43sec 0 39.12sec
Khorelle Khorelle_wolf claw 16827 69427 1775 20.62 3682 7830 13.4 13.4 35.7% 0.0% 0.0% 0.0% 31.72sec 69427 39.12sec
Khorelle Khorelle stormlash 120687 521218 1155 6.20 10056 20162 46.6 46.6 11.1% 0.0% 0.0% 0.0% 7.00sec 521218 451.10sec
Khorelle Khorelle_cat claw 16827 1244321 2758 13.49 9067 18674 101.5 101.5 33.3% 0.0% 0.0% 0.0% 4.48sec 1244321 451.10sec
Khorelle Khorelle_cat melee 0 2948341 6536 43.85 6918 14213 329.7 329.7 33.2% 0.0% 24.0% 0.0% 1.37sec 2948341 451.10sec
Khorelle Khorelle_cat rabid 53401 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.30sec 0 451.10sec
Khorelle Khorelle_cat stormlash 120687 81415 180 5.90 1430 3009 44.3 44.3 25.8% 0.0% 0.0% 0.0% 7.38sec 81415 451.10sec
Xemynia Xemynia alter_time_activate 108978 0 0 0.35 0 0 2.6 2.6 0.0% 0.0% 0.0% 0.0% 197.90sec 0 451.10sec
Xemynia Xemynia arcane_barrage 44425 3107989 6890 2.13 166660 347371 16.0 16.0 15.0% 0.1% 0.0% 0.0% 25.77sec 3107989 451.10sec
Xemynia Xemynia arcane_blast 30451 18350710 40680 18.49 113374 237298 139.0 139.0 15.1% 0.1% 0.0% 0.0% 3.24sec 18350710 451.10sec
Xemynia Xemynia arcane_missiles ticks -5143 14931892 33182 41.15 41622 87290 61.8 308.6 15.3% 0.1% 0.0% 0.0% 7.14sec 14931892 451.10sec
Xemynia Xemynia arcane_power 12042 0 0 0.70 0 0 5.2 5.2 0.0% 0.0% 0.0% 0.0% 94.48sec 0 451.10sec
Xemynia Xemynia mirror_image 55342 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.24sec 0 451.10sec
Xemynia Xemynia_mirror_image arcane_blast 88084 690160 7971 84.04 4866 10038 121.3 121.3 16.0% 0.1% 0.0% 0.0% 3.27sec 690160 86.59sec
Xemynia Xemynia nether_tempest ticks -114923 5844725 12988 65.61 10197 21294 35.4 492.1 15.2% 0.0% 0.0% 0.0% 12.72sec 5844725 451.10sec
Xemynia Xemynia presence_of_mind 12043 0 0 0.72 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 91.31sec 0 451.10sec
Xemynia Xemynia rune_of_power 116011 0 0 0.86 0 0 6.5 6.5 0.0% 0.0% 0.0% 0.0% 64.10sec 0 451.10sec
Xemynia Xemynia stormlash 120687 475571 1054 1.97 26514 57663 14.8 14.8 17.8% 0.1% 0.0% 0.0% 22.92sec 475571 451.10sec
Nerghal Nerghal alter_time_activate 108978 0 0 0.37 0 0 2.8 2.8 0.0% 0.0% 0.0% 0.0% 187.99sec 0 451.10sec
Nerghal Nerghal combustion 11129 611098 1355 0.87 72851 151857 6.5 6.5 26.3% 0.0% 0.0% 0.0% 73.23sec 3385294 451.10sec
Nerghal Nerghal combustion ticks -11129 2774196 6165 20.28 14190 29787 6.5 152.1 26.0% 0.0% 0.0% 0.0% 73.23sec 3385294 451.10sec
Nerghal Nerghal fireball 133 12750146 28265 19.96 61886 128832 150.3 150.1 34.5% 0.0% 0.0% 0.0% 2.99sec 12750146 451.10sec
Nerghal Nerghal ignite ticks -12654 6116944 13593 29.69 27472 0 224.5 222.7 0.0% 0.0% 0.0% 0.0% 2.00sec 6116944 451.10sec
Nerghal Nerghal inferno_blast 108853 1519735 3369 3.91 0 51670 29.4 29.4 100.0% 0.0% 0.0% 0.0% 15.24sec 1519735 451.10sec
Nerghal Nerghal living_bomb ticks -44457 2173071 4829 22.82 9919 20629 34.0 171.2 25.9% 0.0% 0.0% 0.0% 13.35sec 2173071 451.10sec
Nerghal Nerghal living_bomb_explosion 44461 1682692 3730 4.41 39642 82717 34.0 33.2 25.8% 0.0% 0.0% 0.0% 13.24sec 1682692 451.10sec
Nerghal Nerghal mirror_image 55342 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.62sec 0 451.10sec
Nerghal Nerghal_mirror_image fire_blast 59637 153608 1779 30.09 2789 5625 43.3 43.3 26.7% 0.0% 0.0% 0.0% 30.54sec 153608 86.37sec
Nerghal Nerghal_mirror_image frostbolt 59638 547943 6344 104.30 2870 5796 150.7 150.1 26.7% 0.0% 0.0% 0.0% 7.77sec 547943 86.37sec
Nerghal Nerghal presence_of_mind 12043 0 0 0.72 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 91.52sec 0 451.10sec
Nerghal Nerghal pyroblast 11366 7560490 16760 6.02 121997 254596 45.3 45.2 34.0% 0.0% 0.0% 0.0% 9.79sec 12064942 451.10sec
Nerghal Nerghal pyroblast ticks -11366 4504451 10010 21.91 19919 41520 45.3 164.3 34.7% 0.0% 0.0% 0.0% 9.79sec 12064942 451.10sec
Nerghal Nerghal rune_of_power 116011 0 0 0.84 0 0 6.3 6.3 0.0% 0.0% 0.0% 0.0% 63.93sec 0 451.10sec
Nerghal Nerghal stormlash 120687 644760 1429 3.46 18923 39803 26.0 26.0 28.0% 0.0% 0.0% 0.0% 12.75sec 644760 451.10sec
Nerghal Nerghal time_warp 80353 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Bamboozle Bamboozle blackout_kick 100784 6424164 14241 12.67 52285 104832 95.3 95.3 28.8% 0.0% 0.0% 0.0% 4.66sec 6424164 451.10sec
Bamboozle Bamboozle blackout_kick_dot ticks -128531 1275170 2834 40.08 4242 0 95.2 300.6 0.0% 0.0% 0.0% 0.0% 4.66sec 1275170 451.10sec
Bamboozle Bamboozle energizing_brew 115288 0 0 0.94 0 0 7.1 7.1 0.0% 0.0% 0.0% 0.0% 61.24sec 0 451.10sec
Bamboozle Bamboozle fists_of_fury ticks -113656 4070872 9046 8.57 49104 98463 12.9 64.3 28.8% 0.0% 0.0% 0.0% 35.14sec 4070872 451.10sec
Bamboozle Bamboozle jab 100780 2016473 4470 18.89 11004 22060 142.0 142.0 28.9% 0.0% 0.0% 0.0% 3.19sec 2016473 451.10sec
Bamboozle Bamboozle melee_main_hand 0 7238643 16047 32.28 24231 48594 242.7 242.7 28.9% 0.0% 24.1% 0.0% 1.85sec 7238643 451.10sec
Bamboozle Bamboozle rising_sun_kick 107428 5816380 12894 6.39 93783 187745 48.0 48.0 29.1% 0.0% 0.0% 0.0% 9.47sec 5816380 451.10sec
Bamboozle Bamboozle rushing_jade_wind 116847 893216 1980 1.94 56138 112489 14.6 14.6 9.1% 0.0% 0.0% 0.0% 31.65sec 893216 451.10sec
Bamboozle Bamboozle stormlash 120687 504327 1118 7.46 8248 16517 56.1 56.1 9.0% 0.0% 0.0% 0.0% 5.81sec 504327 451.10sec
Bamboozle Bamboozle tiger_palm 100787 1098164 2434 5.16 21934 43932 38.8 38.8 29.0% 0.0% 0.0% 0.0% 11.66sec 1098164 451.10sec
Bamboozle Bamboozle tiger_strikes_melee 0 2137140 4738 9.05 24266 48655 68.0 68.0 29.3% 0.0% 0.0% 0.0% 6.06sec 2137140 451.10sec
Bamboozle Bamboozle tigereye_brew 116740 0 0 1.36 0 0 10.2 10.2 0.0% 0.0% 0.0% 0.0% 42.50sec 0 451.10sec
Sagefraise Sagefraise ancient_fury 86704 177028 392 0.25 79210 162660 1.8 1.8 19.9% 0.0% 0.0% 0.0% 347.10sec 177028 451.10sec
Sagefraise Sagefraise arcane_torrent 28730 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.77sec 0 451.10sec
Sagefraise Sagefraise avenging_wrath 31884 0 0 0.59 0 0 4.4 4.4 0.0% 0.0% 0.0% 0.0% 115.71sec 0 451.10sec
Sagefraise Sagefraise censure ticks -31803 3842731 8539 25.17 16468 34033 358.1 188.7 22.2% 0.0% 0.0% 0.0% 1.26sec 3842731 451.10sec
Sagefraise Sagefraise crusader_strike 35395 2089905 4633 8.82 25606 52760 66.3 66.3 21.8% 0.0% 0.0% 0.0% 6.72sec 2089905 451.10sec
Sagefraise Sagefraise execution_sentence ticks -114157 2206881 4904 10.28 23584 48204 7.8 77.1 20.5% 0.0% 0.0% 0.0% 61.01sec 2206881 451.10sec
Sagefraise Sagefraise exorcism 879 3209438 7115 6.47 54360 112829 48.6 48.6 19.9% 0.0% 0.0% 0.0% 9.30sec 3209438 451.10sec
Sagefraise Sagefraise guardian_of_ancient_kings 86698 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 347.10sec 0 451.10sec
Sagefraise Sagefraise hammer_of_wrath 24275 5483352 12156 7.98 73907 152446 60.0 60.0 22.3% 0.0% 0.0% 0.0% 7.50sec 5483352 451.10sec
Sagefraise Sagefraise hand_of_light 96172 5584217 12379 25.20 29471 0 189.5 189.5 0.0% 0.0% 0.0% 0.0% 2.38sec 5584217 451.10sec
Sagefraise Sagefraise inquisition 84963 0 0 2.02 0 0 15.2 15.2 0.0% 0.0% 0.0% 0.0% 30.42sec 0 451.10sec
Sagefraise Sagefraise judgment 20271 3413557 7567 8.44 43404 89903 63.5 63.5 22.3% 0.0% 0.0% 0.0% 7.11sec 3413557 451.10sec
Sagefraise Sagefraise melee 0 4310492 9556 21.96 22250 45867 165.1 165.1 22.0% 0.0% 23.8% 0.0% 2.72sec 4310492 451.10sec
Sagefraise Sagefraise rebuke 96231 0 0 0.14 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Sagefraise Sagefraise seal_of_truth_proc 31801 2232229 4948 47.62 5044 10428 358.1 358.1 22.1% 0.0% 0.0% 0.0% 1.26sec 2232229 451.10sec
Sagefraise Sagefraise stormlash 120687 609114 1350 5.78 11490 23774 43.5 43.5 20.5% 0.0% 0.0% 0.0% 7.53sec 609114 451.10sec
Sagefraise Sagefraise templars_verdict 85256 5423115 12022 8.41 69318 143120 63.2 63.2 22.3% 0.0% 0.0% 0.0% 7.00sec 5423115 451.10sec
Sagefraise Sagefraise_guardian_of_ancient_kings melee 0 1749158 30124 45.45 42292 0 44.0 44.0 0.0% 0.0% 24.1% 0.0% 8.70sec 1749158 58.07sec
Lienus Lienus devouring_plague 2944 2349284 5208 2.36 111623 230193 17.7 17.7 17.6% 0.0% 0.0% 0.0% 25.24sec 2349284 451.10sec
Lienus Lienus devouring_plague_mastery 124467 758662 1682 4.55 18526 38341 34.2 34.2 18.4% 0.0% 0.0% 0.0% 12.55sec 758662 451.10sec
Lienus Lienus devouring_plague_tick ticks -2944 2756847 6126 16.60 18505 38230 17.7 124.5 18.4% 0.0% 0.0% 0.0% 25.24sec 2756847 451.10sec
Lienus Lienus divine_star 122121 0 0 3.39 0 0 25.5 25.5 18.6% 0.0% 0.0% 0.0% 17.87sec 0 451.10sec
Lienus Lienus divine_star_damage 122128 1280281 2838 6.78 20977 43434 51.0 51.0 18.5% 0.0% 0.0% 0.0% 17.87sec 1280281 451.10sec
Lienus Lienus divine_star_heal 122128 2347514 5204 155.12 1664 3303 51.0 1166.3 21.3% 0.0% 0.0% 0.0% 17.87sec 51554153 451.10sec
Lienus Lienus mind_blast 8092 4953416 10981 6.18 88861 185163 46.5 46.5 18.4% 0.0% 0.0% 0.0% 9.78sec 4953416 451.10sec
Lienus Lienus mind_flay ticks -15407 6288589 13975 29.21 23945 49676 100.8 219.1 18.5% 0.0% 0.0% 0.0% 4.39sec 6288589 451.10sec
Lienus Lienus mind_flay_mastery 124468 1733626 3843 8.11 23702 49284 61.0 61.0 18.5% 0.0% 0.0% 0.0% 7.12sec 1733626 451.10sec
Lienus Lienus mind_spike 73510 2942829 6524 4.41 74130 153586 33.1 33.1 18.4% 0.0% 0.0% 0.0% 13.05sec 2942829 451.10sec
Lienus Lienus shadow_word_death 32379 1721394 3816 2.04 93777 194001 15.3 15.3 18.5% 0.0% 0.0% 0.0% 5.59sec 1721394 451.10sec
Lienus Lienus shadow_word_pain ticks -589 3612570 8028 27.70 13322 27616 26.1 207.7 28.5% 0.0% 0.0% 0.0% 17.58sec 3612570 451.10sec
Lienus Lienus shadow_word_pain_mastery 124464 1045044 2317 7.69 13861 28729 57.8 57.8 28.4% 0.0% 0.0% 0.0% 7.69sec 1045044 451.10sec
Lienus Lienus shadowfiend 34433 0 0 0.39 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 183.56sec 0 451.10sec
Lienus Lienus shadowy_apparition 87532 1401664 3107 9.12 17199 34652 69.8 68.6 18.6% 0.0% 0.0% 0.0% 6.39sec 1401664 451.10sec
Lienus Lienus stormlash 120687 524933 1164 4.81 11835 24778 36.1 36.1 20.8% 0.0% 0.0% 0.0% 9.09sec 524933 451.10sec
Lienus Lienus touch_of_the_grave 5227 388013 860 2.76 18675 0 20.8 20.8 0.0% 0.0% 0.0% 0.0% 21.90sec 388013 451.10sec
Lienus Lienus vampiric_touch ticks -34914 3271950 7271 23.72 15383 31819 29.6 177.9 18.3% 0.0% 0.0% 0.0% 15.33sec 3271950 451.10sec
Lienus Lienus vampiric_touch_mastery 124465 911653 2021 6.55 15516 32171 49.3 49.2 18.0% 0.0% 0.0% 0.0% 8.90sec 911653 451.10sec
Lienus Lienus_shadowfiend melee 0 1569419 45612 51.93 45411 93905 29.8 29.8 20.4% 0.0% 23.6% 0.0% 12.50sec 1569419 34.41sec
Lienus Lienus_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.8 5.8 0.0% 0.0% 0.0% 0.0% 74.79sec 0 34.41sec
Lienus Lienus_shadowfiend stormlash 120687 8258 240 19.08 607 1218 10.9 10.9 24.2% 0.0% 0.0% 0.0% 0.93sec 8258 34.41sec
Brwazou Brwazou ascendance 114049 0 0 0.39 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 184.02sec 0 451.10sec
Brwazou Brwazou berserking 26297 0 0 0.39 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 184.34sec 0 451.10sec
Brwazou Brwazou bloodlust 2825 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Brwazou Brwazou earth_elemental_totem 2062 0 0 0.26 0 0 1.9 1.9 0.0% 0.0% 0.0% 0.0% 302.88sec 0 451.10sec
Brwazou Brwazou earth_shock 8042 448942 995 2.48 18697 48435 18.6 18.6 18.1% 0.0% 0.0% 0.0% 22.80sec 448942 451.10sec
Brwazou Brwazou fulmination 26364 1467484 3253 2.48 60981 158591 18.6 18.6 18.2% 0.0% 0.0% 0.0% 22.80sec 1467484 451.10sec
Brwazou Brwazou earth_shock_eoe 8042 26170 58 0.15 18086 46921 1.1 1.1 19.3% 0.0% 0.0% 0.0% 135.53sec 26170 451.10sec
Brwazou Brwazou elemental_blast 117014 2360986 5234 3.66 66396 171990 27.5 27.5 18.5% 0.0% 0.0% 0.0% 15.92sec 2360986 451.10sec
Brwazou Brwazou elemental_blast_overload 120588 735479 1630 1.51 49757 129065 11.4 11.4 18.8% 0.0% 0.0% 0.0% 36.47sec 735479 451.10sec
Brwazou Brwazou elemental_blast_eoe 117014 134782 299 0.21 66160 171103 1.6 1.6 17.2% 0.0% 0.0% 0.0% 119.26sec 134782 451.10sec
Brwazou Brwazou elemental_blast_overload_eoe 120588 40094 89 0.08 49774 128541 0.6 0.6 19.1% 0.0% 0.0% 0.0% 140.60sec 40094 451.10sec
Brwazou Brwazou fire_elemental_totem 2894 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Brwazou Brwazou flame_shock 8050 201205 446 2.01 10433 27035 15.1 15.1 17.4% 0.0% 0.0% 0.0% 30.78sec 1568036 451.10sec
Brwazou Brwazou flame_shock ticks -8050 1366831 3037 23.68 6010 15558 15.1 177.6 17.7% 0.0% 0.0% 0.0% 30.78sec 1568036 451.10sec
Brwazou Brwazou flame_shock_eoe 8050 11703 26 0.12 10049 26206 0.9 0.9 15.9% 0.0% 0.0% 0.0% 152.57sec 11703 451.10sec
Brwazou Brwazou lava_burst 51505 8471468 18780 11.56 0 97431 87.1 86.9 100.0% 0.0% 0.0% 0.0% 5.15sec 8471468 451.10sec
Brwazou Brwazou lava_burst_overload 77451 2369977 5254 4.39 0 71882 33.1 33.0 100.0% 0.0% 0.0% 0.0% 13.43sec 2369977 451.10sec
Brwazou Brwazou lava_burst_eoe 51505 506963 1124 0.70 35993 96411 5.3 5.3 99.8% 0.0% 0.0% 0.0% 70.74sec 506963 451.10sec
Brwazou Brwazou lava_burst_overload_eoe 77451 145477 322 0.26 27865 74904 2.0 1.9 99.7% 0.0% 0.0% 0.0% 116.08sec 145477 451.10sec
Brwazou Brwazou lightning_bolt 403 5760086 12769 17.44 34126 88425 131.4 131.2 18.0% 0.0% 0.0% 0.0% 3.27sec 5760086 451.10sec
Brwazou Brwazou lightning_bolt_overload 45284 1647911 3653 6.81 24940 64652 51.4 51.2 18.2% 0.0% 0.0% 0.0% 8.31sec 1647911 451.10sec
Brwazou Brwazou lightning_bolt_eoe 403 338715 751 1.05 33105 85822 7.9 7.9 18.9% 0.0% 0.0% 0.0% 47.68sec 338715 451.10sec
Brwazou Brwazou lightning_bolt_overload_eoe 45284 100169 222 0.41 24883 64475 3.1 3.1 18.8% 0.0% 0.0% 0.0% 89.69sec 100169 451.10sec
Brwazou Brwazou searing_totem 3599 0 0 0.78 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 72.03sec 0 451.10sec
Brwazou Brwazou stormlash 120687 917368 2034 5.44 18504 37870 40.9 40.9 20.3% 0.0% 0.0% 0.0% 8.01sec 917368 451.10sec
Brwazou Brwazou wind_shear 57994 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Brwazou Brwazou_greater_fire_elemental fire_blast 57984 116661 973 10.00 4548 11372 20.0 20.0 18.9% 0.0% 0.0% 0.0% 18.77sec 116661 119.89sec
Brwazou Brwazou_greater_fire_elemental fire_melee 0 1491837 12443 51.60 11774 29455 103.1 103.1 19.2% 0.0% 24.0% 0.0% 3.49sec 1491837 119.89sec
Brwazou Brwazou_greater_earth_elemental earth_melee 0 281963 2643 34.95 4102 8205 62.1 62.1 16.7% 0.0% 24.2% 0.0% 5.34sec 281963 106.68sec
Brwazou Brwazou_searing_totem searing_bolt 3606 737998 2448 36.73 3163 7919 185.5 184.6 17.6% 0.0% 0.0% 0.0% 2.06sec 737998 301.50sec
Sagemanda Sagemanda ascendance 114049 0 0 0.39 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.26sec 0 451.10sec
Sagemanda Sagemanda blood_fury 33697 0 0 0.56 0 0 4.2 4.2 0.0% 0.0% 0.0% 0.0% 121.02sec 0 451.10sec
Sagemanda Sagemanda bloodlust 2825 0 0 0.10 0 0 0.8 0.8 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Sagemanda Sagemanda earth_elemental_totem 2062 0 0 0.26 0 0 1.9 1.9 0.0% 0.0% 0.0% 0.0% 302.97sec 0 451.10sec
Sagemanda Sagemanda earth_shock 8042 512308 1136 2.51 21562 56198 18.9 18.9 16.0% 0.0% 0.0% 0.0% 22.30sec 512308 451.10sec
Sagemanda Sagemanda fulmination 26364 1714722 3801 2.51 72239 188814 18.9 18.9 15.9% 0.0% 0.0% 0.0% 22.30sec 1714722 451.10sec
Sagemanda Sagemanda earth_shock_eoe 8042 30549 68 0.16 21032 55167 1.2 1.2 14.2% 0.0% 0.0% 0.0% 135.31sec 30549 451.10sec
Sagemanda Sagemanda elemental_blast 117014 2882798 6391 3.91 77497 202643 29.4 29.4 16.5% 0.0% 0.0% 0.0% 15.39sec 2882798 451.10sec
Sagemanda Sagemanda elemental_blast_overload 120588 900220 1996 1.63 58031 152055 12.3 12.3 16.2% 0.0% 0.0% 0.0% 34.89sec 900220 451.10sec
Sagemanda Sagemanda elemental_blast_eoe 117014 181451 402 0.24 77591 204109 1.8 1.8 17.3% 0.0% 0.0% 0.0% 117.04sec 181451 451.10sec
Sagemanda Sagemanda elemental_blast_overload_eoe 120588 49788 110 0.09 58129 151361 0.7 0.7 17.5% 0.0% 0.0% 0.0% 156.34sec 49788 451.10sec
Sagemanda Sagemanda fire_elemental_totem 2894 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Sagemanda Sagemanda flame_shock 8050 229965 510 2.07 11747 30585 15.6 15.6 16.1% 0.0% 0.0% 0.0% 29.87sec 1827032 451.10sec
Sagemanda Sagemanda flame_shock ticks -8050 1597067 3549 24.93 6804 17770 15.6 186.9 15.9% 0.0% 0.0% 0.0% 29.87sec 1827032 451.10sec
Sagemanda Sagemanda flame_shock_eoe 8050 12931 29 0.12 11330 30014 0.9 0.9 15.7% 0.0% 0.0% 0.0% 141.69sec 12931 451.10sec
Sagemanda Sagemanda lava_burst 51505 10325275 22889 11.56 41867 118837 87.0 86.9 100.0% 0.0% 0.0% 0.0% 5.16sec 10325275 451.10sec
Sagemanda Sagemanda lava_burst_overload 77451 3031251 6720 4.59 0 87855 34.6 34.5 100.0% 0.0% 0.0% 0.0% 12.82sec 3031251 451.10sec
Sagemanda Sagemanda lava_burst_eoe 51505 609125 1350 0.69 37378 116865 5.2 5.2 99.9% 0.0% 0.0% 0.0% 71.28sec 609125 451.10sec
Sagemanda Sagemanda lava_burst_overload_eoe 77451 184329 409 0.27 34303 90734 2.0 2.0 99.7% 0.0% 0.0% 0.0% 116.18sec 184329 451.10sec
Sagemanda Sagemanda lightning_bolt 403 7015638 15552 18.08 41251 107924 136.1 135.9 15.6% 0.0% 0.0% 0.0% 3.13sec 7015638 451.10sec
Sagemanda Sagemanda lightning_bolt_overload 45284 1949784 4322 7.20 28727 75148 54.4 54.2 15.7% 0.0% 0.0% 0.0% 7.80sec 1949784 451.10sec
Sagemanda Sagemanda lightning_bolt_eoe 403 408282 905 1.08 39933 105354 8.1 8.1 15.8% 0.0% 0.0% 0.0% 46.20sec 408282 451.10sec
Sagemanda Sagemanda lightning_bolt_overload_eoe 45284 119658 265 0.45 28669 75631 3.4 3.4 15.0% 0.0% 0.0% 0.0% 85.27sec 119658 451.10sec
Sagemanda Sagemanda searing_totem 3599 0 0 0.78 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 72.67sec 0 451.10sec
Sagemanda Sagemanda stormlash 120687 1130602 2506 5.68 22180 46484 42.7 42.7 17.8% 0.0% 0.0% 0.0% 7.66sec 1130602 451.10sec
Sagemanda Sagemanda wind_shear 57994 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Sagemanda Sagemanda_greater_fire_elemental fire_blast 57984 135737 1132 10.00 5415 13798 20.0 20.0 16.5% 0.0% 0.0% 0.0% 18.76sec 135737 119.89sec
Sagemanda Sagemanda_greater_fire_elemental fire_melee 0 1749978 14596 52.78 13822 35525 105.5 105.5 16.5% 0.0% 24.0% 0.0% 3.41sec 1749978 119.89sec
Sagemanda Sagemanda_greater_earth_elemental earth_melee 0 333235 3116 35.86 4752 9602 63.9 63.9 15.4% 0.0% 24.1% 0.0% 5.19sec 333235 106.96sec
Sagemanda Sagemanda_searing_totem searing_bolt 3606 870404 2859 36.75 3728 9749 187.4 186.5 15.6% 0.0% 0.0% 0.0% 2.05sec 870404 304.49sec
Maguth Maguth agony ticks -980 5891920 13093 38.76 17064 35706 17.4 290.7 17.2% 0.0% 0.0% 0.0% 25.17sec 5891920 451.10sec
Maguth Maguth corruption ticks -172 4499478 9999 38.52 13137 27411 23.3 288.9 17.1% 0.0% 0.0% 0.0% 18.85sec 4499478 451.10sec
Maguth Maguth dark_soul 113860 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.45sec 0 451.10sec
Maguth Maguth drain_soul ticks -1120 1618404 3596 4.01 45316 94234 17.2 30.1 17.3% 0.0% 0.0% 0.0% 5.00sec 1618404 451.10sec
Maguth Maguth agony_ds 980 974396 2160 4.00 27426 56864 30.1 30.1 16.8% 0.0% 0.0% 0.0% 2.75sec 974396 451.10sec
Maguth Maguth corruption_ds 172 750080 1663 4.00 21044 43764 30.1 30.1 17.2% 0.0% 0.0% 0.0% 2.75sec 750080 451.10sec
Maguth Maguth unstable_affliction_ds 30108 895346 1985 4.00 25109 52184 30.1 30.1 17.2% 0.0% 0.0% 0.0% 2.75sec 895346 451.10sec
Maguth Maguth grimoire_of_sacrifice 108503 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Maguth Maguth haunt 48181 3613201 8010 4.79 92036 192047 36.3 36.0 15.8% 8.2% 0.0% 0.0% 12.61sec 3613201 451.10sec
Maguth Maguth life_tap 1454 0 0 1.12 0 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 45.25sec 0 451.10sec
Maguth Maguth malefic_grasp ticks -103103 3531863 7849 37.58 10604 22031 89.9 281.9 16.9% 0.0% 0.0% 0.0% 4.04sec 3531863 451.10sec
Maguth Maguth agony_mg 980 4229061 9375 37.49 12632 26466 281.9 281.9 17.2% 0.0% 0.0% 0.0% 1.29sec 4229061 451.10sec
Maguth Maguth corruption_mg 172 3254945 7216 37.49 9734 20361 281.9 281.9 17.1% 0.0% 0.0% 0.0% 1.29sec 3254945 451.10sec
Maguth Maguth unstable_affliction_mg 30108 3812837 8452 37.49 11440 23835 281.9 281.9 16.8% 0.0% 0.0% 0.0% 1.29sec 3812837 451.10sec
Maguth Maguth soul_swap 86121 79111 175 0.53 18399 38258 4.0 4.0 15.8% 8.4% 0.0% 0.0% 146.18sec 79111 451.10sec
Maguth Maguth soulburn 74434 0 0 0.76 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 92.93sec 0 451.10sec
Maguth Maguth stormlash 120687 778403 1726 5.05 18672 39231 37.9 37.9 16.5% 8.3% 0.0% 0.0% 8.63sec 778403 451.10sec
Maguth Maguth summon_doomguard 18540 0 0 0.27 0 0 1.0 2.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Maguth Maguth touch_of_the_grave 5227 261500 580 2.42 14364 0 18.2 18.2 0.0% 0.0% 0.0% 0.0% 25.10sec 261500 451.10sec
Maguth Maguth unstable_affliction ticks -30108 5286207 11747 38.43 15481 32330 29.3 288.2 17.0% 0.0% 0.0% 0.0% 15.06sec 5286207 451.10sec
Maguth Maguth_felhunter shadow_bite 54049 12877 inf inf 11966 23932 1.0 1.0 15.9% 8.3% 0.0% 0.0% nansec 12877 0.00sec
Maguth Maguth_doomguard doom_bolt 85692 539283 8988 17.00 29275 59904 17.0 17.0 15.9% 8.3% 0.0% 0.0% 3.40sec 539283 60.00sec
Gobarlum Gobarlum battle_shout 6673 0 0 0.69 0 0 5.2 5.2 0.0% 0.0% 0.0% 0.0% 78.57sec 0 451.10sec
Gobarlum Gobarlum berserker_rage 18499 0 0 1.76 0 0 13.2 13.2 0.0% 0.0% 0.0% 0.0% 35.35sec 0 451.10sec
Gobarlum Gobarlum bloodbath ticks -113344 2234513 4966 16.85 17680 0 7.5 126.4 0.0% 0.0% 0.0% 0.0% 64.04sec 2234513 451.10sec
Gobarlum Gobarlum bloodthirst 23881 3638041 8065 12.51 23525 49453 94.1 94.1 58.4% 0.0% 0.0% 0.0% 4.82sec 3638041 451.10sec
Gobarlum Gobarlum bloodthirst_heal 23881 0 0 12.51 0 0 94.1 94.1 24.7% 0.0% 0.0% 0.0% 4.82sec 147872 451.10sec
Gobarlum Gobarlum colossus_smash 86346 1163576 2579 2.87 39880 85108 21.6 21.6 31.0% 0.0% 0.0% 0.0% 21.32sec 1163576 451.10sec
Gobarlum Gobarlum deadly_calm 85730 0 0 0.99 0 0 7.5 7.5 0.0% 0.0% 0.0% 0.0% 64.14sec 0 451.10sec
Gobarlum Gobarlum deep_wounds ticks -115767 2846446 6325 19.98 14450 29972 94.1 149.9 29.3% 0.0% 0.0% 0.0% 4.82sec 2846446 451.10sec
Gobarlum Gobarlum dragon_roar 118000 930133 2062 0.99 0 125465 7.4 7.4 100.0% 0.0% 0.0% 0.0% 64.14sec 930133 451.10sec
Gobarlum Gobarlum elemental_force_oh 0 374917 831 12.86 3150 6489 96.7 96.7 21.8% 0.0% 0.0% 0.0% 4.67sec 374917 451.10sec
Gobarlum Gobarlum execute 5308 5468517 12123 3.33 153145 349069 25.0 25.0 33.4% 0.0% 0.0% 0.0% 3.42sec 5468517 451.10sec
Gobarlum Gobarlum heroic_leap 6544 924327 2049 1.47 59280 131900 11.0 11.0 33.7% 0.0% 0.0% 0.0% 42.66sec 924327 451.10sec
Gobarlum Gobarlum heroic_strike 78 3353789 7435 9.25 36493 76950 69.5 69.5 29.1% 0.0% 0.0% 0.0% 5.24sec 3353789 451.10sec
Gobarlum Gobarlum heroic_throw 57755 164560 365 1.43 11863 24467 10.8 10.8 26.9% 0.0% 0.0% 0.0% 39.62sec 164560 451.10sec
Gobarlum Gobarlum melee_main_hand 0 5064602 11227 21.17 30052 62292 159.2 159.2 26.5% 16.6% 23.8% 0.0% 2.82sec 5064602 451.10sec
Gobarlum Gobarlum melee_off_hand 1 3161701 7009 21.17 18772 38911 159.2 159.2 26.5% 16.7% 23.9% 0.0% 2.82sec 3161701 451.10sec
Gobarlum Gobarlum raging_blow 85288 0 0 8.31 0 0 62.5 62.5 0.0% 0.0% 0.0% 0.0% 7.10sec 0 451.10sec
Gobarlum Gobarlum raging_blow_mh 96103 4546925 10080 8.31 54819 116302 62.5 62.5 29.2% 0.0% 0.0% 0.0% 7.10sec 4546925 451.10sec
Gobarlum Gobarlum raging_blow_oh 85384 2850409 6319 8.31 34277 72585 62.5 62.5 29.6% 0.0% 0.0% 0.0% 7.10sec 2850409 451.10sec
Gobarlum Gobarlum recklessness 1719 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.10sec
Gobarlum Gobarlum stormlash 120687 464516 1030 5.76 8634 17815 43.3 43.3 22.8% 0.0% 0.0% 0.0% 7.57sec 464516 451.10sec
Gobarlum Gobarlum wild_strike 100130 2384314 5286 7.31 34033 69959 54.9 54.9 26.1% 0.0% 0.0% 0.0% 6.34sec 2384314 451.10sec
Tauranax Tauranax avatar 107574 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 180.94sec 0 451.10sec
Tauranax Tauranax battle_shout 6673 0 0 1.02 0 0 7.6 7.6 0.0% 0.0% 0.0% 0.0% 62.50sec 0 451.10sec
Tauranax Tauranax berserker_rage 18499 0 0 2.05 0 0 15.4 15.4 0.0% 0.0% 0.0% 0.0% 30.15sec 0 451.10sec
Tauranax Tauranax deep_wounds ticks -115767 7979982 17733 19.91 49904 100500 197.8 149.4 7.0% 0.0% 0.0% 0.0% 2.28sec 7979982 451.10sec
Tauranax Tauranax demoralizing_shout 1160 0 0 1.00 0 0 7.5 7.5 0.0% 0.0% 0.0% 0.0% 63.05sec 0 451.10sec
Tauranax Tauranax devastate 20243 9991208 22149 17.67 70277 140979 132.9 132.9 7.0% 0.0% 0.0% 0.0% 3.36sec 9991208 451.10sec
Tauranax Tauranax heroic_strike 78 1236526 2741 3.27 46955 93965 24.6 24.6 7.1% 0.0% 0.0% 0.0% 17.92sec 1236526 451.10sec
Tauranax Tauranax last_stand 12975 0 0 0.54 0 0 4.1 4.1 0.0% 0.0% 0.0% 0.0% 121.16sec 0 451.10sec
Tauranax Tauranax melee_main_hand 0 6522783 14460 26.82 32032 63993 201.7 201.7 7.0% 0.0% 24.0% 0.0% 2.23sec 6522783 451.10sec
Tauranax Tauranax revenge 6572 7867725 17441 8.63 113155 226561 64.9 64.9 7.1% 0.0% 0.0% 0.0% 6.97sec 7867725 451.10sec
Tauranax Tauranax shield_barrier 112048 2071383 4592 3.04 148883 0 8.9 22.8 0.0% 0.0% 0.0% 0.0% 45.03sec 2580525 451.10sec
Tauranax Tauranax shield_block 2565 0 0 6.73 0 0 50.6 50.6 0.0% 0.0% 0.0% 0.0% 8.89sec 0 451.10sec
Tauranax Tauranax shield_slam 23922 16916500 37501 10.89 192814 388073 81.8 81.8 7.1% 0.0% 0.0% 0.0% 5.54sec 16916500 451.10sec
Tauranax Tauranax shield_wall 871 0 0 0.48 0 0 3.6 3.6 0.0% 0.0% 0.0% 0.0% 132.02sec 0 451.10sec
Tauranax Tauranax stormlash 120687 1371256 3040 5.81 30728 62321 43.7 43.7 2.1% 0.0% 0.0% 0.0% 7.50sec 1371256 451.10sec

Fluffy_Pillow : 42942 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
42941.7 42941.7 195.83 / 0.46% 5064 / 11.8% -1.0 0.0 0.0 Mana 148.19% 0.3 100.0% 100%

Charts

http://3.chart.apis.google.com/chart?chs=550x90&cht=bhg&chf=bg,s,333333&chd=t:43063|2635&chds=0,86127&chco=C79C6E,C41F3B&chm=t++43063++melee_main_hand,C79C6E,0,0,15|t++2635++spell_nuke_Tauranax,C41F3B,1,0,15&chtt=Fluffy_Pillow Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:100,0&chds=0,100&chdls=ffffff&chco=C79C6E,C41F3B&chl=melee_main_hand|spell_nuke_Tauranax&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:pmsomqnromrqwoovpvrrxsyttytzuuztzuu0tzuu0v1vv2w3xx3y3xx3x2ww0txrrwquoououooupvqqxtzvv1w2yy4z5zz606zz6060060711717005y4yy4y2vv0uzssxrwqqvqwqqwqvrrwsxssxsyttzuzttytztt0u0vv1v1vv1uzuu0v0uuztxqqvpvppuouppvpvppvrxsszv1vv2x3xx3x4zz607117171171600707zz6z3ww1uzttyrxrrxqvppvpuppvrxssytzuu0u0vv1v1ww2w1vv0v0uu0u0tt0u0uuzsxsswqvqqvpuoouotnntpvqqwszuu1v2xx4y5zz60711706zz6z6zz5y5yy4x2ww0uzttzsxrrvpuoovpvqqxsyttzu0vv1w2xx3x2ww2v1vv0u0uu0uzttztzttzsxsswrwqqvpuooupvppwrxsszu0vv2x4zz606006z5zz5z6zz5z5yy5z5yy4y4yy3w0uuysxrrwpvqqxrxrrytzvv2y3yy50711805zz4y3xx0vxtwztworv&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.8123,0.4&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=42942|max=52863&chxp=1,1,81,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,1,1,3,10,5,2,10,14,13,21,33,26,28,35,39,38,43,46,58,48,47,36,58,45,41,39,34,39,41,28,22,25,13,15,9,5,7,2,3,3,3,1,1,0,0,3,0,1&chds=0,58&chbh=5&chxt=x&chxl=0:|min=33853|avg=42942|max=53940&chxp=0,1,45,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:0.5,148.2&chds=0,100&chdls=ffffff&chco=C41F3B,ffffff&chl=spell_nuke_Tauranax 2.3s|waiting 668.5s&chtt=Fluffy_Pillow Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 42942
melee_main_hand 42928 100.0% 179.9 2.50sec 107658 43063 162110 398184 107653 5.1% 25.0% 0.0% 27.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.87 179.87 0.00 0.00 2.5000 0.0000 19364709.96 19364709.96 0.00 43063.41 43063.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.77 17.10% 162110.46 0 228004 161710.58 111288 197898 4987757 4987757 0.00
crit 9.21 5.12% 398183.63 0 456008 398428.52 264727 456008 3666143 3666143 0.00
crit-block 46.12 25.64% 80890.31 0 91202 80909.52 69704 89282 3731097 3731097 0.00
block 48.80 27.13% 143045.22 0 159603 143004.57 122368 156107 6979713 6979713 0.00
parry 24.27 13.49% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 20.71 11.51% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Tauranax
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:700000.00
  • base_dd_max:700000.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spell_nuke_Tauranax 14 0.0% 1.5 451.57sec 4145 2635 4145 0 4145 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spell_nuke_Tauranax

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.49 1.49 0.00 0.00 1.5739 0.0000 6186.31 6186.31 0.00 2634.71 2634.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.49 100.00% 4145.19 0 4500 4235.05 2250 4500 6186 6186 0.00
DPS Timeline Chart

Action details: spell_nuke_Tauranax

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.00
  • base_execute_time:0.10
  • base_crit:0.00
  • target:Tauranax
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:6000.00
  • base_dd_max:6000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.53% 9.53%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.38% 9.38%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.52% 10.52%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.01% 11.01%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.99% 10.99%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.91% 10.91%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.91%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.27% 11.27%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.47% 11.47%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.48% 9.48%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.48%

Trigger Attempt Success

  • trigger_pct:100.00%
censure 1.0 357.1 1.3sec 1.3sec 99.71% 99.86%

Buff details

  • buff initial source:Sagefraise
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.31%
  • censure_2:0.03%
  • censure_3:0.62%
  • censure_4:0.47%
  • censure_5:98.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every {$t1=3} sec.
  • description:Deals ${{$m1=0}*5} additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 21.6 0.0 21.3sec 21.3sec 28.52% 35.03%

Buff details

  • buff initial source:Gobarlum
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • colossus_smash_1:28.52%

Trigger Attempt Success

  • trigger_pct:100.00%
demoralizing_shout 7.5 0.0 63.1sec 63.1sec 16.55% 28.53%

Buff details

  • buff initial source:Tauranax
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_1:16.55%

Trigger Attempt Success

  • trigger_pct:100.00%
haunt 21.4 11.6 20.7sec 13.8sec 57.74% 60.15%

Buff details

  • buff initial source:Maguth
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • haunt_1:57.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for {$d=8 seconds}.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
pyromaniac 5.4 28.6 88.0sec 13.4sec 98.25% 98.61%

Buff details

  • buff initial source:Nerghal
  • cooldown name:buff_pyromaniac
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • pyromaniac_1:98.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132209
  • name:Pyromaniac
  • tooltip:
  • description:Your Nether Tempest, Living Bomb, and Frost Bomb spells now also apply the Pyromaniac effect. $@spellname132210 {$@spelldesc132210=Increases the damage done by your Fireball, Pyroblast, Inferno Blast, and Frostfire Bolt on the target by $s1%. Lasts {$d=15 seconds}.}
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
rising_sun_kick 1.1 47.0 232.9sec 9.5sec 99.75% 99.74%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_rising_sun_kick
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rising_sun_kick_1:99.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:130320
  • name:Rising Sun Kick
  • tooltip:Damage taken from abilities dealt by the Monk increased $w1%.
  • description:{$@spelldesc107428=You kick upwards, dealing ${14.4*$<low>} to ${14.4*$<high>} damage and applying Mortal Wounds to the target. Also causes all targets within $130320A1 yards to take an increased {$130320m1=15}% damage from your abilities for {$130320d=15 seconds}. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
rushing_jade_wind 1.0 13.6 0.0sec 31.7sec 98.78% 98.78%

Buff details

  • buff initial source:Bamboozle
  • cooldown name:buff_rushing_jade_wind
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • rushing_jade_wind_1:98.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1157801.84
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 999
Mean 451.10
Minimum 348.85
Maximum 556.73
Spread ( max - min ) 207.88
Range [ ( max - min ) / 2 * 100% ] 23.04%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 999
Mean 42941.73
Minimum 33853.00
Maximum 53940.07
Spread ( max - min ) 20087.07
Range [ ( max - min ) / 2 * 100% ] 23.39%
Standard Deviation 3158.0843
5th Percentile 37852.38
95th Percentile 47980.19
( 95th Percentile - 5th Percentile ) 10127.82
Mean Distribution
Standard Deviation 99.9174
95.00% Confidence Intervall ( 42745.90 - 43137.57 )
Normalized 95.00% Confidence Intervall ( 99.54% - 100.46% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 207
0.1% Error 20777
0.1 Scale Factor Error with Delta=300 85139
0.05 Scale Factor Error with Delta=300 340558
0.01 Scale Factor Error with Delta=300 8513950
Distribution Chart

DPS(e)

Sample Data
Count 999
Mean 42941.73
Distribution Chart

Damage

Sample Data
Count 999
Mean 19370896.26
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 999
Mean 1160806.76
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 999
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 999
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 999
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 999
Mean 2.49
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats
Default action list
# count action,conditions
1 1.00 auto_attack,damage=700000,attack_speed=2.5,aoe_tanks=1
2 1.49 spell_nuke,damage=6000,cooldown=4,attack_speed=0.1,aoe_tanks=1

Sample Sequence

122

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 626513673 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% -nan% 0
Spell Haste inf% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% 5.00% 0
Melee Haste inf% 0.00% 0
Swing Speed inf% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 0 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
spec=unknown
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

actions.precombat=snapshot_stats

actions=auto_attack,damage=700000,attack_speed=2.5,aoe_tanks=1
actions+=/spell_nuke,damage=6000,cooldown=4,attack_speed=0.1,aoe_tanks=1


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.